PDB entry 4xi2

View 4xi2 on RCSB PDB site
Description: Crystal Structure of an auto-inhibited form of Bruton's Tryrosine Kinase
Class: transferase
Keywords: Kinase, Phosphorylation, Auto-inhibited, B-Cell development, X-linked agammaglobulinemia, TRANSFERASE
Deposited on 2015-01-06, released 2015-02-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-03-11, with a file datestamp of 2015-03-06.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase BTK
    Species: Mus musculus [TaxId:10090]
    Gene: Btk, Bpk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4xi2a1, d4xi2a2
  • Heterogens: AU

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xi2A (A:)
    telkkvvalydympmnandlqlrkgeeyfileesnlpwwrardkngqegyipsnyiteae
    dsiemyewyskhmtrsqaeqllkqegkeggfivrdsskagkytvsvfakstgepqgvirh
    yvvcstpqsqyylaekhlfstipelinyhqhnsaglisrlkypvskqnknapstaglgyg
    sweidpkdltflkelgtgqfgvvkygkwrgqydvaikmiregsmsedefieeakvmmnls
    heklvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvceameyle
    skqflhrdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrwsppevlmysk
    fssksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlaservytimysc
    whekaderpsfkillsnildvmdees
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xi2A (A:)
    telkkvvalydympmnandlqlrkgeeyfileesnlpwwrardkngqegyipsnyiteae
    dsiemyewyskhmtrsqaeqlleggfivrdytvsvfakgvirhyvvcyylaekhlfstip
    elinyhqhnsaglisrlkypvskqnknapstaglgygsweidpkdltflkelgtgqfgvv
    kygkwrgqydvaikmiregsmsedefieeakvmmnlsheklvqlygvctkqrpifiitey
    mangcllnylremrhrfqtqqllemckdvceameyleskqflhrdlaarnclvndqgvvk
    vsdfglsryvlddeytssvgskfpvrwsppevlmyskfssksdiwafgvlmweiyslgkm
    pyerftnsetaehiaqglrlyrphlaservytimyscwhekaderpsfkillsnildvmd
    e