PDB entry 4xgs

View 4xgs on RCSB PDB site
Description: Crystal structure analysis of novel iron uptake mechanism of Gram-negative bacterial ferritin
Class: metal binding protein
Keywords: ferritin, Escherichia coli, mutant, ferroxidase center, novel iron uptake route, METAL BINDING PROTEIN
Deposited on 2015-01-02, released 2016-07-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-21, with a file datestamp of 2016-12-16.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferritin
    Species: Escherichia coli K12 [TaxId:83333]
    Gene: ftnA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A998 (1-End)
      • expression tag (0)
      • engineered mutation (92)
    Domains in SCOPe 2.07: d4xgsa1, d4xgsa2
  • Chain 'B':
    Compound: Ferritin
    Species: Escherichia coli K12 [TaxId:83333]
    Gene: ftnA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A998 (1-End)
      • expression tag (0)
      • engineered mutation (92)
    Domains in SCOPe 2.07: d4xgsb1, d4xgsb2
  • Chain 'C':
    Compound: Ferritin
    Species: Escherichia coli K12 [TaxId:83333]
    Gene: ftnA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A998 (1-End)
      • expression tag (0)
      • engineered mutation (92)
    Domains in SCOPe 2.07: d4xgsc1, d4xgsc2
  • Chain 'D':
    Compound: Ferritin
    Species: Escherichia coli K12 [TaxId:83333]
    Gene: ftnA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A998 (1-End)
      • expression tag (0)
      • engineered mutation (92)
    Domains in SCOPe 2.07: d4xgsd1, d4xgsd2
  • Chain 'E':
    Compound: Ferritin
    Species: Escherichia coli K12 [TaxId:83333]
    Gene: ftnA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A998 (1-End)
      • expression tag (0)
      • engineered mutation (92)
    Domains in SCOPe 2.07: d4xgse1, d4xgse2
  • Chain 'F':
    Compound: Ferritin
    Species: Escherichia coli K12 [TaxId:83333]
    Gene: ftnA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A998 (1-End)
      • expression tag (0)
      • engineered mutation (92)
    Domains in SCOPe 2.07: d4xgsf1, d4xgsf2
  • Heterogens: OFO, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xgsA (A:)
    hlkpemieklneqmnlelyssllyqqmsawcsyhtfegaaaflrrhaqeemthmqrlfdy
    ltdtgnlprintvespfaeyssldelfqetykleqlitqkinelahaamtnqdyptfnfl
    qwyvseqheeeklfksiidklslagksgeglyfidkelstldtqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xgsA (A:)
    hlkpemieklneqmnlelyssllyqqmsawcsyhtfegaaaflrrhaqeemthmqrlfdy
    ltdtgnlprintvespfaeyssldelfqetykleqlitqkinelahaamtnqdyptfnfl
    qwyvseqheeeklfksiidklslagksgeglyfidkelstldt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4xgsB (B:)
    hlkpemieklneqmnlelyssllyqqmsawcsyhtfegaaaflrrhaqeemthmqrlfdy
    ltdtgnlprintvespfaeyssldelfqetykleqlitqkinelahaamtnqdyptfnfl
    qwyvseqheeeklfksiidklslagksgeglyfidkelstldtqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xgsB (B:)
    hlkpemieklneqmnlelyssllyqqmsawcsyhtfegaaaflrrhaqeemthmqrlfdy
    ltdtgnlprintvespfaeyssldelfqetykleqlitqkinelahaamtnqdyptfnfl
    qwyvseqheeeklfksiidklslagksgeglyfidkelstldtq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4xgsC (C:)
    hlkpemieklneqmnlelyssllyqqmsawcsyhtfegaaaflrrhaqeemthmqrlfdy
    ltdtgnlprintvespfaeyssldelfqetykleqlitqkinelahaamtnqdyptfnfl
    qwyvseqheeeklfksiidklslagksgeglyfidkelstldtqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xgsC (C:)
    hlkpemieklneqmnlelyssllyqqmsawcsyhtfegaaaflrrhaqeemthmqrlfdy
    ltdtgnlprintvespfaeyssldelfqetykleqlitqkinelahaamtnqdyptfnfl
    qwyvseqheeeklfksiidklslagksgeglyfidkelstldtq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4xgsD (D:)
    hlkpemieklneqmnlelyssllyqqmsawcsyhtfegaaaflrrhaqeemthmqrlfdy
    ltdtgnlprintvespfaeyssldelfqetykleqlitqkinelahaamtnqdyptfnfl
    qwyvseqheeeklfksiidklslagksgeglyfidkelstldtqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xgsD (D:)
    hlkpemieklneqmnlelyssllyqqmsawcsyhtfegaaaflrrhaqeemthmqrlfdy
    ltdtgnlprintvespfaeyssldelfqetykleqlitqkinelahaamtnqdyptfnfl
    qwyvseqheeeklfksiidklslagksgeglyfidkelstldt
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4xgsE (E:)
    hlkpemieklneqmnlelyssllyqqmsawcsyhtfegaaaflrrhaqeemthmqrlfdy
    ltdtgnlprintvespfaeyssldelfqetykleqlitqkinelahaamtnqdyptfnfl
    qwyvseqheeeklfksiidklslagksgeglyfidkelstldtqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xgsE (E:)
    hlkpemieklneqmnlelyssllyqqmsawcsyhtfegaaaflrrhaqeemthmqrlfdy
    ltdtgnlprintvespfaeyssldelfqetykleqlitqkinelahaamtnqdyptfnfl
    qwyvseqheeeklfksiidklslagksgeglyfidkelstldt
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4xgsF (F:)
    hlkpemieklneqmnlelyssllyqqmsawcsyhtfegaaaflrrhaqeemthmqrlfdy
    ltdtgnlprintvespfaeyssldelfqetykleqlitqkinelahaamtnqdyptfnfl
    qwyvseqheeeklfksiidklslagksgeglyfidkelstldtqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xgsF (F:)
    hlkpemieklneqmnlelyssllyqqmsawcsyhtfegaaaflrrhaqeemthmqrlfdy
    ltdtgnlprintvespfaeyssldelfqetykleqlitqkinelahaamtnqdyptfnfl
    qwyvseqheeeklfksiidklslagksgeglyfidkelstldt