PDB entry 4xgp

View 4xgp on RCSB PDB site
Description: Crystal Structure of E112A/H234A Mutant of Stationary Phase Survival Protein (SurE) from Salmonella typhimurium co-crystallized and soaked with AMP.
Class: hydrolase
Keywords: Stationary phase survival protein, Domain swapping, Rossmann fold like, Phosphatase, HYDROLASE
Deposited on 2015-01-01, released 2015-09-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-09-09, with a file datestamp of 2015-09-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'/3'-nucleotidase SurE
    Species: Salmonella typhimurium LT2 [TaxId:99287]
    Gene: surE, STM2927
    Database cross-references and differences (RAF-indexed):
    • Uniprot P66881 (14-266)
      • expression tag (3-13)
      • engineered mutation (125)
      • engineered mutation (247)
    Domains in SCOPe 2.07: d4xgpa1, d4xgpa2
  • Chain 'B':
    Compound: 5'/3'-nucleotidase SurE
    Species: Salmonella typhimurium LT2 [TaxId:99287]
    Gene: surE, STM2927
    Database cross-references and differences (RAF-indexed):
    • Uniprot P66881 (14-266)
      • expression tag (10-13)
      • engineered mutation (125)
      • engineered mutation (247)
    Domains in SCOPe 2.07: d4xgpb1, d4xgpb2
  • Chain 'C':
    Compound: 5'/3'-nucleotidase SurE
    Species: Salmonella typhimurium LT2 [TaxId:99287]
    Gene: surE, STM2927
    Database cross-references and differences (RAF-indexed):
    • Uniprot P66881 (14-266)
      • expression tag (12-13)
      • engineered mutation (125)
      • engineered mutation (247)
    Domains in SCOPe 2.07: d4xgpc1, d4xgpc2
  • Chain 'D':
    Compound: 5'/3'-nucleotidase SurE
    Species: Salmonella typhimurium LT2 [TaxId:99287]
    Gene: surE, STM2927
    Database cross-references and differences (RAF-indexed):
    • Uniprot P66881 (14-266)
      • expression tag (13)
      • engineered mutation (125)
      • engineered mutation (247)
    Domains in SCOPe 2.07: d4xgpd1, d4xgpd2
  • Heterogens: MG, PO4, ADE, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xgpA (A:)
    mrgshhhhhhgmasmrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnslt
    lesslrtftfdngdiavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgt
    vaaamagrhlgfpalavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlpla
    qvkgirvtrcgsrhpadkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtp
    lhvdltaasahdvvsdwldsvgvgtqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xgpA (A:)
    shhhhhhgmasmrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnsltles
    slrtftfdngdiavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgtvaa
    amagrhlgfpalavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlplaqvk
    girvtrcgsrhpadkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtplhv
    dltaasahdvvsdwldsvgvgtqw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4xgpB (B:)
    mrgshhhhhhgmasmrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnslt
    lesslrtftfdngdiavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgt
    vaaamagrhlgfpalavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlpla
    qvkgirvtrcgsrhpadkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtp
    lhvdltaasahdvvsdwldsvgvgtqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xgpB (B:)
    gmasmrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnsltlesslrtftf
    dngdiavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgtvaaamagrhl
    gfpalavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlplaqvkgirvtrc
    gsrhpadkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtplhvdltaasa
    hdvvsdwldsvgvgtqw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4xgpC (C:)
    mrgshhhhhhgmasmrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnslt
    lesslrtftfdngdiavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgt
    vaaamagrhlgfpalavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlpla
    qvkgirvtrcgsrhpadkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtp
    lhvdltaasahdvvsdwldsvgvgtqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xgpC (C:)
    asmrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnsltlesslrtftfdn
    gdiavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgtvaaamagrhlgf
    palavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlplaqvkgirvtrcgs
    rhpadkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtplhvdltaasahd
    vvsdwldsvgvgtqw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4xgpD (D:)
    mrgshhhhhhgmasmrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnslt
    lesslrtftfdngdiavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgt
    vaaamagrhlgfpalavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlpla
    qvkgirvtrcgsrhpadkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtp
    lhvdltaasahdvvsdwldsvgvgtqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xgpD (D:)
    smrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnsltlesslrtftfdng
    diavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgtvaaamagrhlgfp
    alavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlplaqvkgirvtrcgsr
    hpadkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtplhvdltaasahdv
    vsdwldsvgvgtqw