PDB entry 4xgi

View 4xgi on RCSB PDB site
Description: Crystal structure of Glutamate dehydrogenase from Burkholderia thailandensis
Class: oxidoreductase
Keywords: SSGCID, Glutamate dehydrogenase, Burkholderia thailandensis, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, OXIDOREDUCTASE
Deposited on 2014-12-30, released 2015-01-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-01-14, with a file datestamp of 2015-01-09.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.177
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamate dehydrogenase
    Species: Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) [TaxId:271848]
    Gene: BTH_I1224, DR63_1118
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4xgia1, d4xgia2
  • Chain 'B':
    Compound: glutamate dehydrogenase
    Species: Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) [TaxId:271848]
    Gene: BTH_I1224, DR63_1118
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4xgib1, d4xgib2
  • Chain 'C':
    Compound: glutamate dehydrogenase
    Species: Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) [TaxId:271848]
    Gene: BTH_I1224, DR63_1118
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4xgic1, d4xgic2
  • Chain 'D':
    Compound: glutamate dehydrogenase
    Species: Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) [TaxId:271848]
    Gene: BTH_I1224, DR63_1118
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4xgid1, d4xgid2
  • Chain 'E':
    Compound: glutamate dehydrogenase
    Species: Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) [TaxId:271848]
    Gene: BTH_I1224, DR63_1118
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4xgie1, d4xgie2
  • Chain 'F':
    Compound: glutamate dehydrogenase
    Species: Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) [TaxId:271848]
    Gene: BTH_I1224, DR63_1118
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4xgif1, d4xgif2
  • Heterogens: NAD, AKG, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xgiA (A:)
    gsmssqsqspsvaqsipsylhaddlgpwgnylqqvdrvapylgslsrwietlkrpkrili
    vdvpieldngtvahfegyrvqhnvsrgpgkggvryhqdvtlsevmalsawmsvknaavnv
    pyggakggirvdprklsrgelervtrrytseigiiigpntdipapdvntneqimawmmdt
    ysmnqgqtatgvvtgkpislggslgrkeatgrgvfvvgceaakkkgveiegariavqgfg
    nvggiaaklfqeagakviavqdhtgtihqpagvdtaklldhvgrtggvagfegaepmpnd
    efwtveteilipaalenqiteknaskirtkiivegangptttaaddilsangvlvipdvi
    anaggvtvsyfewvqdfssffwtedeinhrlervmreafagvwavaeehkvsvrtaafiv
    ackrilmaremrglyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xgiA (A:)
    sipsylhaddlgpwgnylqqvdrvapylgslsrwietlkrpkrilivdvpieldngtvah
    fegyrvqhnvsrgpgkggvryhqdvtlsevmalsawmsvknaavnvpyggakggirvdpr
    klsrgelervtrrytseigiiigpntdipapdvntneqimawmmdtysmnqgqtatgvvt
    gkpislggslgrkeatgrgvfvvgceaakkkgveiegariavqgfgnvggiaaklfqeag
    akviavqdhtgtihqpagvdtaklldhvgrtggvagfegaepmpndefwtveteilipaa
    lenqiteknaskirtkiivegangptttaaddilsangvlvipdvianaggvtvsyfewv
    qwtedeinhrlervmreafagvwavaeehkvsvrtaafivackrilmaremrglyp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4xgiB (B:)
    gsmssqsqspsvaqsipsylhaddlgpwgnylqqvdrvapylgslsrwietlkrpkrili
    vdvpieldngtvahfegyrvqhnvsrgpgkggvryhqdvtlsevmalsawmsvknaavnv
    pyggakggirvdprklsrgelervtrrytseigiiigpntdipapdvntneqimawmmdt
    ysmnqgqtatgvvtgkpislggslgrkeatgrgvfvvgceaakkkgveiegariavqgfg
    nvggiaaklfqeagakviavqdhtgtihqpagvdtaklldhvgrtggvagfegaepmpnd
    efwtveteilipaalenqiteknaskirtkiivegangptttaaddilsangvlvipdvi
    anaggvtvsyfewvqdfssffwtedeinhrlervmreafagvwavaeehkvsvrtaafiv
    ackrilmaremrglyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xgiB (B:)
    sipsylhaddlgpwgnylqqvdrvapylgslsrwietlkrpkrilivdvpieldngtvah
    fegyrvqhnvsrgpgkggvryhqdvtlsevmalsawmsvknaavnvpyggakggirvdpr
    klsrgelervtrrytseigiiigpntdipapdvntneqimawmmdtysmnqgqtatgvvt
    gkpislggslgrkeatgrgvfvvgceaakkkgveiegariavqgfgnvggiaaklfqeag
    akviavqdhtgtihqpagvdtaklldhvgrtggvagfegaepmpndefwtveteilipaa
    lenqiteknaskirtkiivegangptttaaddilsangvlvipdvianaggvtvsyfewv
    qtedeinhrlervmreafagvwavaeehkvsvrtaafivackrilmaremrglyp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4xgiC (C:)
    gsmssqsqspsvaqsipsylhaddlgpwgnylqqvdrvapylgslsrwietlkrpkrili
    vdvpieldngtvahfegyrvqhnvsrgpgkggvryhqdvtlsevmalsawmsvknaavnv
    pyggakggirvdprklsrgelervtrrytseigiiigpntdipapdvntneqimawmmdt
    ysmnqgqtatgvvtgkpislggslgrkeatgrgvfvvgceaakkkgveiegariavqgfg
    nvggiaaklfqeagakviavqdhtgtihqpagvdtaklldhvgrtggvagfegaepmpnd
    efwtveteilipaalenqiteknaskirtkiivegangptttaaddilsangvlvipdvi
    anaggvtvsyfewvqdfssffwtedeinhrlervmreafagvwavaeehkvsvrtaafiv
    ackrilmaremrglyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xgiC (C:)
    sipsylhaddlgpwgnylqqvdrvapylgslsrwietlkrpkrilivdvpieldngtvah
    fegyrvqhnvsrgpgkggvryhqdvtlsevmalsawmsvknaavnvpyggakggirvdpr
    klsrgelervtrrytseigiiigpntdipapdvntneqimawmmdtysmnqgqtatgvvt
    gkpislggslgrkeatgrgvfvvgceaakkkgveiegariavqgfgnvggiaaklfqeag
    akviavqdhtgtihqpagvdtaklldhvgrtggvagfegaepmpndefwtveteilipaa
    lenqiteknaskirtkiivegangptttaaddilsangvlvipdvianaggvtvsyfewv
    qwtedeinhrlervmreafagvwavaeehkvsvrtaafivackrilmaremrglyp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4xgiD (D:)
    gsmssqsqspsvaqsipsylhaddlgpwgnylqqvdrvapylgslsrwietlkrpkrili
    vdvpieldngtvahfegyrvqhnvsrgpgkggvryhqdvtlsevmalsawmsvknaavnv
    pyggakggirvdprklsrgelervtrrytseigiiigpntdipapdvntneqimawmmdt
    ysmnqgqtatgvvtgkpislggslgrkeatgrgvfvvgceaakkkgveiegariavqgfg
    nvggiaaklfqeagakviavqdhtgtihqpagvdtaklldhvgrtggvagfegaepmpnd
    efwtveteilipaalenqiteknaskirtkiivegangptttaaddilsangvlvipdvi
    anaggvtvsyfewvqdfssffwtedeinhrlervmreafagvwavaeehkvsvrtaafiv
    ackrilmaremrglyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xgiD (D:)
    sipsylhaddlgpwgnylqqvdrvapylgslsrwietlkrpkrilivdvpieldngtvah
    fegyrvqhnvsrgpgkggvryhqdvtlsevmalsawmsvknaavnvpyggakggirvdpr
    klsrgelervtrrytseigiiigpntdipapdvntneqimawmmdtysmnqgqtatgvvt
    gkpislggslgrkeatgrgvfvvgceaakkkgveiegariavqgfgnvggiaaklfqeag
    akviavqdhtgtihqpagvdtaklldhvgrtggvagfegaepmpndefwtveteilipaa
    lenqiteknaskirtkiivegangptttaaddilsangvlvipdvianaggvtvsyfewv
    qtedeinhrlervmreafagvwavaeehkvsvrtaafivackrilmaremrglyp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4xgiE (E:)
    gsmssqsqspsvaqsipsylhaddlgpwgnylqqvdrvapylgslsrwietlkrpkrili
    vdvpieldngtvahfegyrvqhnvsrgpgkggvryhqdvtlsevmalsawmsvknaavnv
    pyggakggirvdprklsrgelervtrrytseigiiigpntdipapdvntneqimawmmdt
    ysmnqgqtatgvvtgkpislggslgrkeatgrgvfvvgceaakkkgveiegariavqgfg
    nvggiaaklfqeagakviavqdhtgtihqpagvdtaklldhvgrtggvagfegaepmpnd
    efwtveteilipaalenqiteknaskirtkiivegangptttaaddilsangvlvipdvi
    anaggvtvsyfewvqdfssffwtedeinhrlervmreafagvwavaeehkvsvrtaafiv
    ackrilmaremrglyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xgiE (E:)
    sipsylhaddlgpwgnylqqvdrvapylgslsrwietlkrpkrilivdvpieldngtvah
    fegyrvqhnvsrgpgkggvryhqdvtlsevmalsawmsvknaavnvpyggakggirvdpr
    klsrgelervtrrytseigiiigpntdipapdvntneqimawmmdtysmnqgqtatgvvt
    gkpislggslgrkeatgrgvfvvgceaakkkgveiegariavqgfgnvggiaaklfqeag
    akviavqdhtgtihqpagvdtaklldhvgrtggvagfegaepmpndefwtveteilipaa
    lenqiteknaskirtkiivegangptttaaddilsangvlvipdvianaggvtvsyfewv
    qtedeinhrlervmreafagvwavaeehkvsvrtaafivackrilmaremrglyp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4xgiF (F:)
    gsmssqsqspsvaqsipsylhaddlgpwgnylqqvdrvapylgslsrwietlkrpkrili
    vdvpieldngtvahfegyrvqhnvsrgpgkggvryhqdvtlsevmalsawmsvknaavnv
    pyggakggirvdprklsrgelervtrrytseigiiigpntdipapdvntneqimawmmdt
    ysmnqgqtatgvvtgkpislggslgrkeatgrgvfvvgceaakkkgveiegariavqgfg
    nvggiaaklfqeagakviavqdhtgtihqpagvdtaklldhvgrtggvagfegaepmpnd
    efwtveteilipaalenqiteknaskirtkiivegangptttaaddilsangvlvipdvi
    anaggvtvsyfewvqdfssffwtedeinhrlervmreafagvwavaeehkvsvrtaafiv
    ackrilmaremrglyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xgiF (F:)
    sipsylhaddlgpwgnylqqvdrvapylgslsrwietlkrpkrilivdvpieldngtvah
    fegyrvqhnvsrgpgkggvryhqdvtlsevmalsawmsvknaavnvpyggakggirvdpr
    klsrgelervtrrytseigiiigpntdipapdvntneqimawmmdtysmnqgqtatgvvt
    gkpislggslgrkeatgrgvfvvgceaakkkgveiegariavqgfgnvggiaaklfqeag
    akviavqdhtgtihqpagvdtaklldhvgrtggvagfegaepmpndefwtveteilipaa
    lenqiteknaskirtkiivegangptttaaddilsangvlvipdvianaggvtvsyfewv
    qtedeinhrlervmreafagvwavaeehkvsvrtaafivackrilmaremrglyp