PDB entry 4xgb

View 4xgb on RCSB PDB site
Description: Crystal Structure of E112A/H234A Mutant of Stationary Phase Survival Protein (SurE) from Salmonella typhimurium co-crystallized with AMP
Class: hydrolase
Keywords: Stationary phase survival protein, Domain swapping, Rossmann fold like, Phosphatase, HYDROLASE
Deposited on 2014-12-30, released 2015-09-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-09-09, with a file datestamp of 2015-09-04.
Experiment type: XRAY
Resolution: 2.23 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'/3'-nucleotidase SurE
    Species: Salmonella typhimurium LT2 [TaxId:99287]
    Gene: surE, STM2927
    Database cross-references and differences (RAF-indexed):
    • Uniprot P66881 (14-266)
      • expression tag (5-13)
      • engineered mutation (125)
      • engineered mutation (247)
    Domains in SCOPe 2.07: d4xgba1, d4xgba2
  • Chain 'B':
    Compound: 5'/3'-nucleotidase SurE
    Species: Salmonella typhimurium LT2 [TaxId:99287]
    Gene: surE, STM2927
    Database cross-references and differences (RAF-indexed):
    • Uniprot P66881 (14-266)
      • expression tag (10-13)
      • engineered mutation (125)
      • engineered mutation (247)
    Domains in SCOPe 2.07: d4xgbb1, d4xgbb2
  • Chain 'C':
    Compound: 5'/3'-nucleotidase SurE
    Species: Salmonella typhimurium LT2 [TaxId:99287]
    Gene: surE, STM2927
    Database cross-references and differences (RAF-indexed):
    • Uniprot P66881 (14-266)
      • expression tag (12-13)
      • engineered mutation (125)
      • engineered mutation (247)
    Domains in SCOPe 2.07: d4xgbc1, d4xgbc2
  • Chain 'D':
    Compound: 5'/3'-nucleotidase SurE
    Species: Salmonella typhimurium LT2 [TaxId:99287]
    Gene: surE, STM2927
    Database cross-references and differences (RAF-indexed):
    • Uniprot P66881 (14-266)
      • expression tag (13)
      • engineered mutation (125)
      • engineered mutation (247)
    Domains in SCOPe 2.07: d4xgbd1, d4xgbd2
  • Heterogens: MG, PO4, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xgbA (A:)
    mrgshhhhhhgmasmrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnslt
    lesslrtftfdngdiavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgt
    vaaamagrhlgfpalavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlpla
    qvkgirvtrcgsrhpadkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtp
    lhvdltaasahdvvsdwldsvgvgtqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xgbA (A:)
    hhhhhgmasmrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnsltlessl
    rtftfdngdiavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgtvaaam
    agrhlgfpalavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlplaqvkgi
    rvtrcgsrhpadkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtplhvdl
    taasahdvvsdwldsvgvgtqw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4xgbB (B:)
    mrgshhhhhhgmasmrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnslt
    lesslrtftfdngdiavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgt
    vaaamagrhlgfpalavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlpla
    qvkgirvtrcgsrhpadkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtp
    lhvdltaasahdvvsdwldsvgvgtqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xgbB (B:)
    gmasmrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnsltlesslrtftf
    dngdiavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgtvaaamagrhl
    gfpalavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlplaqvkgirvtrc
    gsrhpadkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtplhvdltaasa
    hdvvsdwldsvgvgtqw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4xgbC (C:)
    mrgshhhhhhgmasmrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnslt
    lesslrtftfdngdiavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgt
    vaaamagrhlgfpalavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlpla
    qvkgirvtrcgsrhpadkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtp
    lhvdltaasahdvvsdwldsvgvgtqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xgbC (C:)
    asmrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnsltlesslrtftfdn
    gdiavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgtvaaamagrhlgf
    palavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlplaqvkgirvtrcgs
    rhpadkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtplhvdltaasahd
    vvsdwldsvgvgtqw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4xgbD (D:)
    mrgshhhhhhgmasmrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnslt
    lesslrtftfdngdiavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgt
    vaaamagrhlgfpalavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlpla
    qvkgirvtrcgsrhpadkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtp
    lhvdltaasahdvvsdwldsvgvgtqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xgbD (D:)
    smrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnsltlesslrtftfdng
    diavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgtvaaamagrhlgfp
    alavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlplaqvkgirvtrcgsr
    hpadkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtplhvdltaasahdv
    vsdwldsvgvgtqw