PDB entry 4xg6

View 4xg6 on RCSB PDB site
Description: Crystal structure of an inhibitor-bound Syk
Class: transferase/transferase inhibitor
Keywords: Syk kinase, Inhibitor, Spleen tyrosine kinase, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2014-12-30, released 2015-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-10-19, with a file datestamp of 2016-10-14.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase SYK
    Species: Homo sapiens [TaxId:9606]
    Gene: SYK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43405 (Start-279)
      • expression tag (280)
    Domains in SCOPe 2.07: d4xg6a1, d4xg6a2
  • Heterogens: X6G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xg6A (A:)
    eeirpkevyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpalkd
    ellaeanvmqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielv
    hqvsmgmkyleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthgkwp
    vkwyapecinyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpa
    gcpremydlmnlcwtydvenrpgfaavelrlrnyyydvvnlehhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xg6A (A:)
    vyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpalkdellaean
    vmqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgm
    kyleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthpvkwyapecin
    yykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremydlm
    nlcwtydvenrpgfaavelrlrnyyydvvnl