PDB entry 4xfa

View 4xfa on RCSB PDB site
Description: cysteine dioxygenase variant - Y157F at pH 8.0 in complex with homocysteine
Class: oxidoreductase
Keywords: Cupin Fold, cysteine to cysteine sulfinic acid catalysis, thiol dioxygenase, OXIDOREDUCTASE
Deposited on 2014-12-26, released 2016-02-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cysteine dioxygenase type 1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Cdo1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21816
      • engineered mutation (156)
    Domains in SCOPe 2.07: d4xfaa_
  • Heterogens: FE, HCS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xfaA (A:)
    mertellkprtladlirilhelfagdevnveevqavleayesnpaewalyakfdqyrytr
    nlvdqgngkfnlmilcwgeghgssihdhtdshcflkllqgnlketlfdwpdkksnemikk
    sertlrenqcayindsiglhrvenvshtepavslhlfsppfdtchafdqrtghknkvtmt
    fhskfgirtpfttsgslenn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xfaA (A:)
    ellkprtladlirilhelfagdevnveevqavleayesnpaewalyakfdqyrytrnlvd
    qgngkfnlmilcwgeghgssihdhtdshcflkllqgnlketlfdwpdkksnemikksert
    lrenqcayindsiglhrvenvshtepavslhlfsppfdtchafdqrtghknkvtmtfhsk
    fgirtp