PDB entry 4xf1
View 4xf1 on RCSB PDB site
Description: cysteine dioxygenase variant - Y157F at pH 8.0 with cysteine
Class: oxidoreductase
Keywords: Cupin Fold, cysteine to cysteine sulfinic acid catalysis, Cytosol, thiol dioxygenase, OXIDOREDUCTASE
Deposited on
2014-12-25, released
2016-04-06
The last revision prior to the SCOPe 2.08 freeze date was dated
2019-12-04, with a file datestamp of
2019-11-29.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.45
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Cysteine dioxygenase type 1
Species: Rattus norvegicus [TaxId:10116]
Gene: Cdo1
Database cross-references and differences (RAF-indexed):
- Uniprot P21816
- engineered mutation (156)
Domains in SCOPe 2.08: d4xf1a_ - Heterogens: FE, CYS, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>4xf1A (A:)
mertellkprtladlirilhelfagdevnveevqavleayesnpaewalyakfdqyrytr
nlvdqgngkfnlmilcwgeghgssihdhtdshcflkllqgnlketlfdwpdkksnemikk
sertlrenqcayindsiglhrvenvshtepavslhlfsppfdtchafdqrtghknkvtmt
fhskfgirtpfttsgslenn
Sequence, based on observed residues (ATOM records): (download)
>4xf1A (A:)
ellkprtladlirilhelfagdevnveevqavleayesnpaewalyakfdqyrytrnlvd
qgngkfnlmilcwgeghgssihdhtdshcflkllqgnlketlfdwpdkksnemikksert
lrenqcayindsiglhrvenvshtepavslhlfsppfdtchafdqrtghknkvtmtfhsk
fgirtp