PDB entry 4xey

View 4xey on RCSB PDB site
Description: Crystal structure of an SH2-kinase domain construct of c-Abl tyrosine kinase
Class: transferase/transferase inhibitor
Keywords: tyrosine kinase, kinase domain, SH2 domain, dasatinib, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2014-12-25, released 2015-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2.89 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase ABL1
    Species: Homo sapiens [TaxId:9606]
    Gene: ABL1, ABL, JTK7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4xeya_
  • Chain 'B':
    Compound: Tyrosine-protein kinase ABL1
    Species: Homo sapiens [TaxId:9606]
    Gene: ABL1, ABL, JTK7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4xeyb1, d4xeyb2
  • Heterogens: 1N1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xeyA (A:)
    masvnslekhswyhgpvsrnaaeyllssgingsflvresesspgqrsislryegrvyhyr
    intasdgklyvssesrfntlaelvhhhstvadglittlhypapkrnkptvygvspnydkw
    emertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaavmkeikh
    pnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvllymatqissameyle
    kknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapeslaynk
    fsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyelmrac
    wqwnpsdrpsfaeihqafetmfqessisdevekelgkqgvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xeyA (A:)
    nydkwemertditmkhklggevyegvwkkysltvavktlkedtmeveeflkeaavmkeik
    hpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvllymatqissameyl
    ekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapeslayn
    kfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyelmra
    cwqwnpsdrpsfaeihqafetmfqessis
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4xeyB (B:)
    masvnslekhswyhgpvsrnaaeyllssgingsflvresesspgqrsislryegrvyhyr
    intasdgklyvssesrfntlaelvhhhstvadglittlhypapkrnkptvygvspnydkw
    emertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaavmkeikh
    pnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvllymatqissameyle
    kknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapeslaynk
    fsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyelmrac
    wqwnpsdrpsfaeihqafetmfqessisdevekelgkqgvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xeyB (B:)
    lekhswyhgpvsrnaaeyllssgingsflvresesspgqrsislryegrvyhyrintasd
    gklyvsrfntlaelvhhhstvadglittlhypapkydkwemertditmkhklevyegvwk
    kysltvavktltmeveeflkeaavmkeikhpnlvqllgvctreppfyiitefmtygnlld
    ylrecnrqevnavvllymatqissameylekknfihrdlaarnclvgenhlvkvadfgls
    rlmtgdtytahagakfpikwtapeslaynkfsiksdvwafgvllweiatygmspypgidl
    sqvyellekdyrmerpegcpekvyelmracwqwnpsdrpsfaeihqafetmfqessisd