PDB entry 4xep

View 4xep on RCSB PDB site
Description: Crystal Structure of F222 form of E112A/H234A Mutant of Stationary Phase Survival Protein (SurE) from Salmonella typhimurium
Class: hydrolase
Keywords: Stationary phase survival protein, Domain swapping, Rossmann fold like, Phosphatase, HYDROLASE
Deposited on 2014-12-24, released 2015-09-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-09-09, with a file datestamp of 2015-09-04.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'/3'-nucleotidase SurE
    Species: Salmonella typhimurium LT2 [TaxId:99287]
    Gene: surE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P66881 (14-266)
      • expression tag (12-13)
      • engineered mutation (125)
      • engineered mutation (247)
    Domains in SCOPe 2.07: d4xepa1, d4xepa2
  • Heterogens: MG, PO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xepA (A:)
    mrgshhhhhhgmasmrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnslt
    lesslrtftfdngdiavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgt
    vaaamagrhlgfpalavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlpla
    qvkgirvtrcgsrhpadkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtp
    lhvdltaasahdvvsdwldsvgvgtqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xepA (A:)
    asmrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnsltlesslrtftfdn
    gdiavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgtvaaamagrhlgf
    palavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlplaqvkgirvtrcgs
    rhpadkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtplhvdltaasahd
    vvsdwldsvgvgtqw