PDB entry 4xeh

View 4xeh on RCSB PDB site
Description: Apo structure of KARI from Ignisphaera aggregans
Class: oxidoreductase
Keywords: Rossmann fold, KARI, OXIDOREDUCTASE
Deposited on 2014-12-23, released 2015-04-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-04-22, with a file datestamp of 2015-04-17.
Experiment type: XRAY
Resolution: 1.39 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ketol-acid reductoisomerase
    Species: Ignisphaera aggregans [TaxId:583356]
    Gene: ilvC, Igag_1561
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4xeha1, d4xeha2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xehA (A:)
    makiykdedislepiknktiailgygsqgrawalnlrdsglnvvvglerqgdswrraidd
    gfkpmytkdavaiadiivflvpdmvqkslwlnsvkdfmkkgadlvfahgfnihfkiiepp
    kdsdvymiapkspgpivrrsyemgggvpalvavyqnvsgealqkalaiakgigcaragvi
    estfkeetetdlfgeqvilvggimelikasfetlveegyqpevayfetvnelklivdliy
    ekgltgmlravsdtakyggitvgkfiidksvrdkmkivlerirsgefarewikeyergmp
    tvfkelselegstietvgrklremmfrgmkqisshlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xehA (A:)
    akiykdedislepiknktiailgygsqgrawalnlrdsglnvvvglerqgdswrraiddg
    fkpmytkdavaiadiivflvpdmvqkslwlnsvkdfmkkgadlvfahgfnihfkiieppk
    dsdvymiapkspgpivrrsyemgggvpalvavyqnvsgealqkalaiakgigcaragvie
    stfkeetetdlfgeqvilvggimelikasfetlveegyqpevayfetvnelklivdliye
    kgltgmlravsdtakyggitvgkfiidksvrdkmkivlerirsgefarewikeyergmpt
    vfkelselegstietvgrklremmfrg