PDB entry 4xe3

View 4xe3 on RCSB PDB site
Description: OleP, the cytochrome P450 epoxidase from Streptomyces antibioticus involved in Oleandomycin biosynthesis: functional analysis and crystallographic structure in complex with clotrimazole.
Class: oxidoreductase
Keywords: P450, clotrimazole, epoxidase, oleandomycin, OXIDOREDUCTASE
Deposited on 2014-12-22, released 2015-11-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P-450
    Species: Streptomyces antibioticus [TaxId:1890]
    Gene: oleP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4xe3a_
  • Chain 'B':
    Compound: Cytochrome P-450
    Species: Streptomyces antibioticus [TaxId:1890]
    Gene: oleP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4xe3b_
  • Heterogens: HEM, CL6, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xe3A (A:)
    mtdthtgptpadavpaypfslphaldldphyaelrrdepvsrvrlpygegtawlvtrmsd
    arivlgdsrfstaaatdpatprmfptppepdgvlaqdppdhtrlrrlvgkaftarrveem
    rprvrslvdsllddmvahgspadlveflavpfpvavicellgvpledrdlfrtfsdamls
    strltaaeiqrvqqdfmvymdglvaqrrdaptedllgalalatdnddhltkgeivnmgvs
    lliaghetsvnqitnlvhlllterkryeslvadpalvpaaveemlrytplvsagsfvrva
    tedvelstvtvragepcvvhfasanrdeevfdhadeldfhrernphiafghgahhcigaq
    lgrlelqealsalvrrfptldlaepvaglkwkqgmlirglerqivsw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xe3A (A:)
    vpaypfslphaldldphyaelrrdepvsrvrlpygegtawlvtrmsdarivlgdsrfsta
    aatdpatprmfptppepdgvlaqdppdhtrlrrlvgkaftarrveemrprvrslvdslld
    dmvahgspadlveflavpfpvavicellgvpledrdlfrtfsdamlsstrltaaeiqrvq
    qdfmvymdglvaqrrdaptedllgalalatdnddhltkgeivnmgvslliaghetsvnqi
    tnlvhlllterkryeslvadpalvpaaveemlrytplvsagsfvrvatedvelstvtvra
    gepcvvhfasanrdeevfdhadeldfhrernphiafghgahhcigaqlgrlelqealsal
    vrrfptldlaepvaglkwkqgmlirglerqivsw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4xe3B (B:)
    mtdthtgptpadavpaypfslphaldldphyaelrrdepvsrvrlpygegtawlvtrmsd
    arivlgdsrfstaaatdpatprmfptppepdgvlaqdppdhtrlrrlvgkaftarrveem
    rprvrslvdsllddmvahgspadlveflavpfpvavicellgvpledrdlfrtfsdamls
    strltaaeiqrvqqdfmvymdglvaqrrdaptedllgalalatdnddhltkgeivnmgvs
    lliaghetsvnqitnlvhlllterkryeslvadpalvpaaveemlrytplvsagsfvrva
    tedvelstvtvragepcvvhfasanrdeevfdhadeldfhrernphiafghgahhcigaq
    lgrlelqealsalvrrfptldlaepvaglkwkqgmlirglerqivsw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xe3B (B:)
    vpaypfslphaldldphyaelrrdepvsrvrlpygegtawlvtrmsdarivlgdsrfsta
    aatdpatprmfptppepdgvlaqdppdhtrlrrlvgkaftarrveemrprvrslvdslld
    dmvahgspadlveflavpfpvavicellgvpledrdlfrtfsdamlsstrltaaeiqrvq
    qdfmvymdglvaqrrdaptedllgalalatdnddhltkgeivnmgvslliaghetsvnqi
    tnlvhlllterkryeslvadpalvpaaveemlrytplvsagsfvrvatedvelstvtvra
    gepcvvhfasanrdeevfdhadeldfhrernphiafghgahhcigaqlgrlelqealsal
    vrrfptldlaepvaglkwkqgmlirglerqivsw