PDB entry 4xdx

View 4xdx on RCSB PDB site
Description: The crystal structure of soluble human interleukin 8 expressed in Pichia pastoris
Class: cytokine
Keywords: Cytokine, alpha beta protein, IL8 fold, chemokine
Deposited on 2014-12-20, released 2015-12-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 0.95 Å
R-factor: N/A
AEROSPACI score: 0.88 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: interleukin-8
  Species: Homo sapiens [TaxId:9606]
  Gene: CXCL8, IL8
  Database cross-references and differences (RAF-indexed):
  • Uniprot P10145 (0-69)
  Domains in SCOPe 2.08: d4xdxa_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4xdxA (A:)
  kelrcqciktyskpfhpkfikelrviesgphcanteiivklsdgrelcldpkenwvqrvv
  ekflkraens