PDB entry 4xdq

View 4xdq on RCSB PDB site
Description: Crystal structure of a Glycoside hydrolase family protein (Rv0315 ortholog) from Mycobacterium thermorestibile
Class: hydrolase
Keywords: structural genomics, National Institute for Allergy and Infectious Diseases, NIAID, tuberculosis, ortholog, calcium-binding, hydrolase, Seattle Structural Genomics Center for Infectious Disease, SSGCID
Deposited on 2014-12-19, released 2015-01-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-01-14, with a file datestamp of 2015-01-09.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.126
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycoside hydrolase family protein
    Species: Mycobacterium thermoresistibile ATCC 19527 [TaxId:1078020]
    Gene: KEK_10413
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4xdqa_
  • Heterogens: CA, CD, MG, CL, BEZ, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xdqA (A:)
    mahhhhhhaqpvldapapgpdtpeaasgpgllfadefdgpagsppdpakwfivperetir
    npvewdkpynmgryvtdqehvfhdgngnlviratrgpganirekyasakivglwrggvgt
    twearvklncltdgawpafwllnddpvrgaeidifewygnrdwpsgatvhakldgtmfqt
    qnypvdsawhtwrmtwlpsgmyfwqdyepgkepfftvlanslpewpfndpgytmvpvfni
    avggsggrepaggsypadmiidwirvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xdqA (A:)
    llfadefdgpagsppdpakwfivperetirnpvewdkpynmgryvtdqehvfhdgngnlv
    iratrgpganirekyasakivglwrggvgttwearvklncltdgawpafwllnddpvrga
    eidifewygnrdwpsgatvhakldgtmfqtqnypvdsawhtwrmtwlpsgmyfwqdyepg
    kepfftvlanslpewpfndpgytmvpvfniavggsggrepaggsypadmiidwirvf