PDB entry 4xdp

View 4xdp on RCSB PDB site
Description: Crystal structure of human KDM4C catalytic domain bound to tris
Class: oxidoreductase
Keywords: lysine-specific demethylase 4c
Deposited on 2014-12-19, released 2015-03-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-07-01, with a file datestamp of 2015-06-26.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysine-specific demethylase 4c
    Species: Homo sapiens [TaxId:9606]
    Gene: KDM4C, GASC1, JHDM3C, JMJD2C, KIAA0780
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4xdpa_
  • Chain 'B':
    Compound: lysine-specific demethylase 4c
    Species: Homo sapiens [TaxId:9606]
    Gene: KDM4C, GASC1, JHDM3C, JMJD2C, KIAA0780
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4xdpb_
  • Heterogens: ZN, FE, TRS, PGE, EDO, CL, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4xdpA (A:)
    lnpsckimtfrpsmeefrefnkylaymeskgahraglakvippkewkprqcyddidnlli
    papiqqmvtgqsglftqyniqkkamtvkefrqlansgkyctpryldyedlerkywknltf
    vapiygadingsiydegvdewniarlntvldvveeecgisiegvntpylyfgmwkttfaw
    htedmdlysinylhfgepkswyaippehgkrlerlaqgffpsssqgcdaflrhkmtlisp
    svlkkygipfdkitqeagefmitfpygyhagfnhgfncaestnfatvrwidygkvaklct
    crkdmvkismdifvrkfqpdryqlwkqgkdiytidhtk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4xdpB (B:)
    lnpsckimtfrpsmeefrefnkylaymeskgahraglakvippkewkprqcyddidnlli
    papiqqmvtgqsglftqyniqkkamtvkefrqlansgkyctpryldyedlerkywknltf
    vapiygadingsiydegvdewniarlntvldvveeecgisiegvntpylyfgmwkttfaw
    htedmdlysinylhfgepkswyaippehgkrlerlaqgffpsssqgcdaflrhkmtlisp
    svlkkygipfdkitqeagefmitfpygyhagfnhgfncaestnfatvrwidygkvaklct
    crkdmvkismdifvrkfqpdryqlwkqgkdiytidhtk