PDB entry 4xd2

View 4xd2 on RCSB PDB site
Description: Horse liver alcohol dehydrogenase-NADH complex
Class: oxidoreductase
Keywords: nadh, horse liver, adh, oxidoreductase
Deposited on 2014-12-18, released 2015-01-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: N/A
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alcohol dehydrogenase e chain
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4xd2a1, d4xd2a2
  • Chain 'B':
    Compound: alcohol dehydrogenase e chain
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4xd2b1, d4xd2b2
  • Heterogens: ZN, NAI, MRD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4xd2A (A:)
    stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
    lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
    gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaasplekvcligcgfstgy
    gsavkvakvtqgstcavfglggvglsvimgckaagaariigvdinkdkfakakevgatec
    vnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccqeaygvsvivgvppdsqn
    lsmnpmlllsgrtwkgaifggfkskdsvpklvadfmakkfaldplithvlpfekinegfd
    llrsgesirtiltf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4xd2B (B:)
    stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
    lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
    gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaasplekvcligcgfstgy
    gsavkvakvtqgstcavfglggvglsvimgckaagaariigvdinkdkfakakevgatec
    vnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccqeaygvsvivgvppdsqn
    lsmnpmlllsgrtwkgaifggfkskdsvpklvadfmakkfaldplithvlpfekinegfd
    llrsgesirtiltf