PDB entry 4xct

View 4xct on RCSB PDB site
Description: Crystal structure of a hydroxamate based inhibitor ARP101 (EN73) in complex with the MMP-9 catalytic domain.
Class: hydrolase
Keywords: Inhibitor-complex, metalloprotease, hydrolase
Deposited on 2014-12-18, released 2015-04-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-10-07, with a file datestamp of 2015-10-02.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Matrix metalloproteinase-9,Matrix metalloproteinase-9
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP9, CLG4B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4xcta_
  • Heterogens: N73, ZN, CA, DMS, EDO, GOL, PGO, BUD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4xctA (A:)
dlkwhhhnitywiqnysedlpraviddafarafalwsavtpltftrvysrdadiviqfgv
aehgdgypfdgkdgllahafppgpgiqgdahfdddelwslgkgvgyslflvaahefghal
gldhssvpealmypmyrftegpplhkddvngirhlyg