PDB entry 4xch

View 4xch on RCSB PDB site
Description: S-ribosylhomocysteinase from Streptococcus suis
Class: lyase
Keywords: S-ribosylhomocysteinase, LYASE
Deposited on 2014-12-18, released 2015-06-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: S-ribosylhomocysteine lyase
    Species: Streptococcus suis [TaxId:1307]
    Gene: luxS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4xcha_
  • Chain 'B':
    Compound: S-ribosylhomocysteine lyase
    Species: Streptococcus suis [TaxId:1307]
    Gene: luxS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4xchb_
  • Chain 'C':
    Compound: S-ribosylhomocysteine lyase
    Species: Streptococcus suis [TaxId:1307]
    Gene: luxS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4xchc_
  • Chain 'D':
    Compound: S-ribosylhomocysteine lyase
    Species: Streptococcus suis [TaxId:1307]
    Gene: luxS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4xchd_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xchA (A:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsmkkevtvesfeldhtivkapyirlis
    eevgpkgdiitnfdirliqpnenamdtaglhtiehllaklirqridglidcspfgcrtgf
    hmimwgkqdsekiaqvikssleeiaegitwedvpgttiescgnykdhslhsakewaklil
    sqgistdaferkpi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xchA (A:)
    ldhtivkapyirliseevgpkgdiitnfdirliqpnenamdtaglhtiehllaklirqri
    dglidcspfgcrtgfhmimwgkqdsekiaqvikssleeiaegitwedvpgttiescgnyk
    dhslhsakewaklilsqgistdaferkpi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4xchB (B:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsmkkevtvesfeldhtivkapyirlis
    eevgpkgdiitnfdirliqpnenamdtaglhtiehllaklirqridglidcspfgcrtgf
    hmimwgkqdsekiaqvikssleeiaegitwedvpgttiescgnykdhslhsakewaklil
    sqgistdaferkpi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xchB (B:)
    ldhtivkapyirliseevgpkgdiitnfdirliqpnenamdtaglhtiehllaklirqri
    dglidcspfgcrtgfhmimwgkqdsekiaqvikssleeiaegitwedvpgttiescgnyk
    dhslhsakewaklilsqgistdaferkpi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4xchC (C:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsmkkevtvesfeldhtivkapyirlis
    eevgpkgdiitnfdirliqpnenamdtaglhtiehllaklirqridglidcspfgcrtgf
    hmimwgkqdsekiaqvikssleeiaegitwedvpgttiescgnykdhslhsakewaklil
    sqgistdaferkpi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xchC (C:)
    ldhtivkapyirliseevgpkgdiitnfdirliqpnenamdtaglhtiehllaklirqri
    dglidcspfgcrtgfhmimwgkqdsekiaqvikssleeiaegitwedvpgttiescgnyk
    dhslhsakewaklilsqgistdaferkpi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4xchD (D:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsmkkevtvesfeldhtivkapyirlis
    eevgpkgdiitnfdirliqpnenamdtaglhtiehllaklirqridglidcspfgcrtgf
    hmimwgkqdsekiaqvikssleeiaegitwedvpgttiescgnykdhslhsakewaklil
    sqgistdaferkpi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xchD (D:)
    ldhtivkapyirliseevgpkgdiitnfdirliqpnenamdtaglhtiehllaklirqri
    dglidcspfgcrtgfhmimwgkqdsekiaqvikssleeiaegitwedvpgttiescgnyk
    dhslhsakewaklilsqgistdaferkpi