PDB entry 4xc0

View 4xc0 on RCSB PDB site
Description: N-terminal domain of Hsp90 from Dictyostelium discoideum in complex with ACP
Class: chaperone
Keywords: Hsp90, ACP, chaperone
Deposited on 2014-12-17, released 2015-12-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-12-09, with a file datestamp of 2015-12-04.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heat shock cognate 90 kDa protein
    Species: DICTYOSTELIUM DISCOIDEUM [TaxId:44689]
    Gene: hspD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4xc0a_
  • Heterogens: ACP, MG, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xc0A (A:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdrwgsmaesqverftfqaeinqlmsliin
    tfysnkevflrelisnasdaldkiryqsltdasvleskteleikiipdktaktltlidsg
    igmtktdmvknlgtiarsgtknfmeqlqsgaadismigqfgvgfysaylvadtvivhskn
    nddeqyvwessaggeftialdhteplgrgtkivlhmkedqldyldetkiknlvkkhsefi
    qypislltikekevdeett
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xc0A (A:)
    aesqverftfqaeinqlmsliintfysnkevflrelisnasdaldkiryqsltdasvles
    kteleikiipdktaktltlidsgigmtktdmvknlgtiarsgtknfmeqlqsgaadismi
    gqfgvgfysaylvadtvivhsknnddeqyvwessaggeftialdhteplgrgtkivlhmk
    edqldyldetkiknlvkkhsefiqypislltik