PDB entry 4xb3

View 4xb3 on RCSB PDB site
Description: Structure of dextran glucosidase
Class: hydrolase
Keywords: glycoside hydrolase, dextran glucosidase, intermediate, HYDROLASE
Deposited on 2014-12-16, released 2015-08-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-08-26, with a file datestamp of 2015-08-21.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucan 1,6-alpha-glucosidase
    Species: STREPTOCOCCUS MUTANS UA159 [TaxId:210007]
    Gene: dexB, SMU_883
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99040 (0-535)
      • conflict (71)
      • engineered mutation (235)
      • engineered mutation (535)
    Domains in SCOPe 2.07: d4xb3a1, d4xb3a2
  • Heterogens: CA, P6G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4xb3A (A:)
    mqkhwwhkatvyqiypksfmdtngdgigdlkgitskldylqklgvmaiwlspvydspmdd
    ngydianyeaiadifgnmadmdnlltqakmrgikiimdlvvnhtsdehawfiearehpds
    serdyyiwcdqpndlesifggsawqyddksdqyylhffskkqpdlnwenanlrqkiydmm
    nfwidkgiggfrmdvidmigkipaqhivsngpklhaylkemnaasfgqhdlltvgqtwga
    tpeiakqysnpvnhelsmvfqfehiglqhkpeapkwdyvkelnvpalktifnkwqtelel
    gqgwnslfwnnhdlprvlsiwgntgkyreksakalaillhlmrgtpyiyqgeeigmtnyp
    fkdlnelddieslnyakeaftngksmetimdsirmigrdnartpmqwdasqnagfstadk
    twlpvnpnykdinvqaalknsnsifytyqqliqlrkendwlvdadfellptadkvfaylr
    kvreerylivvnvsdqeevleidvdkqetlisntnesaalanhklqpwdafcikil