PDB entry 4xau

View 4xau on RCSB PDB site
Description: Crystal structure of AtS13 from Actinomadura melliaura
Class: transferase
Keywords: sugar aminotransferase, Structural Genomics, PSI-2, Protein Structure Initiative, Enzyme Discovery for Natural Product Biosynthesis, NatPro, TRANSFERASE
Deposited on 2014-12-15, released 2014-12-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative aminotransferase
    Species: Actinomadura melliaura [TaxId:360723]
    Gene: atS13
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0H2X1 (20-388)
      • expression tag (17-19)
    Domains in SCOPe 2.07: d4xaua1, d4xaua2
  • Chain 'B':
    Compound: Putative aminotransferase
    Species: Actinomadura melliaura [TaxId:360723]
    Gene: atS13
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0H2X1 (20-388)
      • expression tag (11-19)
    Domains in SCOPe 2.07: d4xaub1, d4xaub2
  • Chain 'C':
    Compound: Putative aminotransferase
    Species: Actinomadura melliaura [TaxId:360723]
    Gene: atS13
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0H2X1 (20-388)
      • expression tag (15-19)
    Domains in SCOPe 2.07: d4xauc1, d4xauc2
  • Chain 'D':
    Compound: Putative aminotransferase
    Species: Actinomadura melliaura [TaxId:360723]
    Gene: atS13
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0H2X1 (20-388)
      • expression tag (11-19)
    Domains in SCOPe 2.07: d4xaud1, d4xaud2
  • Chain 'E':
    Compound: Putative aminotransferase
    Species: Actinomadura melliaura [TaxId:360723]
    Gene: atS13
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0H2X1 (20-388)
      • expression tag (16-19)
    Domains in SCOPe 2.07: d4xaue1, d4xaue2
  • Chain 'F':
    Compound: Putative aminotransferase
    Species: Actinomadura melliaura [TaxId:360723]
    Gene: atS13
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0H2X1 (20-388)
      • expression tag (16-19)
    Domains in SCOPe 2.07: d4xauf1, d4xauf2
  • Chain 'G':
    Compound: Putative aminotransferase
    Species: Actinomadura melliaura [TaxId:360723]
    Gene: atS13
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0H2X1 (20-388)
      • expression tag (16-19)
    Domains in SCOPe 2.07: d4xaug1, d4xaug2
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xauA (A:)
    mgsshhhhhhssglvprgshmiplfkvavsptaldrvaevfasgylgqgprvaefesala
    arlgnprvvsvhsgtsglclalrlldapeerdevlstpltfeatnwailadgrritwvdv
    dpatltmdlddlerkispatraiivvhwtgypvdldrlagildraerehgfrpaviedca
    hawgasyrgvplgshgnmcvfsfqalkhltcgdgglltlpgdelheramlrrfygidrta
    drlrgaydvaewglkwhmtdlnaaiglanletvdeqlrlhrenaafydkeltgvpglell
    qrspdregsfyvydvkvddrpafhrkmeaagimaglvsrrndehscvahlrtslpgldsv
    ydrmvslpvgwwlteqdrehvvatirsgw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xauA (A:)
    gshmiplfkvavsptaldrvaevfasgylgqgprvaefesalaarlgnprvvsvhsgtsg
    lclalrlldapeerdevlstpltfeatnwailadgrritwvdvdpatltmdlddlerkis
    patraiivvhwtgypvdldrlagildraerehgfrpaviedcahawgasyrgvplgshgn
    mcvfsfqalkhltcgdgglltlpgdelheramlrrfygidrtadrlrgaydvaewglkwh
    mtdlnaaiglanletvdeqlrlhrenaafydkeltgvpglellqrspdregsfyvydvkv
    ddrpafhrkmeaagimaglvsrrndehscvahlrtslpgldsvydrmvslpvgwwlteqd
    rehvvatirsgw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4xauB (B:)
    mgsshhhhhhssglvprgshmiplfkvavsptaldrvaevfasgylgqgprvaefesala
    arlgnprvvsvhsgtsglclalrlldapeerdevlstpltfeatnwailadgrritwvdv
    dpatltmdlddlerkispatraiivvhwtgypvdldrlagildraerehgfrpaviedca
    hawgasyrgvplgshgnmcvfsfqalkhltcgdgglltlpgdelheramlrrfygidrta
    drlrgaydvaewglkwhmtdlnaaiglanletvdeqlrlhrenaafydkeltgvpglell
    qrspdregsfyvydvkvddrpafhrkmeaagimaglvsrrndehscvahlrtslpgldsv
    ydrmvslpvgwwlteqdrehvvatirsgw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xauB (B:)
    sglvprgshmiplfkvavsptaldrvaevfasgylgqgprvaefesalaarlgnprvvsv
    hsgtsglclalrlldapeerdevlstpltfeatnwailadgrritwvdvdpatltmdldd
    lerkispatraiivvhwtgypvdldrlagildraerehgfrpaviedcahawgasyrgvp
    lgshgnmcvfsfqalkhltcgdgglltlpgdelheramlrrfygidrtadrlrgaydvae
    wglkwhmtdlnaaiglanletvdeqlrlhrenaafydkeltgvpglellqrspdregsfy
    vydvkvddrpafhrkmeaagimaglvsrrndehscvahlrtslpgldsvydrmvslpvgw
    wlteqdrehvvatirsgw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4xauC (C:)
    mgsshhhhhhssglvprgshmiplfkvavsptaldrvaevfasgylgqgprvaefesala
    arlgnprvvsvhsgtsglclalrlldapeerdevlstpltfeatnwailadgrritwvdv
    dpatltmdlddlerkispatraiivvhwtgypvdldrlagildraerehgfrpaviedca
    hawgasyrgvplgshgnmcvfsfqalkhltcgdgglltlpgdelheramlrrfygidrta
    drlrgaydvaewglkwhmtdlnaaiglanletvdeqlrlhrenaafydkeltgvpglell
    qrspdregsfyvydvkvddrpafhrkmeaagimaglvsrrndehscvahlrtslpgldsv
    ydrmvslpvgwwlteqdrehvvatirsgw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xauC (C:)
    prgshmiplfkvavsptaldrvaevfasgylgqgprvaefesalaarlgnprvvsvhsgt
    sglclalrlldapeerdevlstpltfeatnwailadgrritwvdvdpatltmdlddlerk
    ispatraiivvhwtgypvdldrlagildraerehgfrpaviedcahawgasyrgvplgsh
    gnmcvfsfqalkhltcgdgglltlpgdelheramlrrfygidrtadrlrgaydvaewglk
    whmtdlnaaiglanletvdeqlrlhrenaafydkeltgvpglellqrspdregsfyvydv
    kvddrpafhrkmeaagimaglvsrrndehscvahlrtslpgldsvydrmvslpvgwwlte
    qdrehvvatirsgw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4xauD (D:)
    mgsshhhhhhssglvprgshmiplfkvavsptaldrvaevfasgylgqgprvaefesala
    arlgnprvvsvhsgtsglclalrlldapeerdevlstpltfeatnwailadgrritwvdv
    dpatltmdlddlerkispatraiivvhwtgypvdldrlagildraerehgfrpaviedca
    hawgasyrgvplgshgnmcvfsfqalkhltcgdgglltlpgdelheramlrrfygidrta
    drlrgaydvaewglkwhmtdlnaaiglanletvdeqlrlhrenaafydkeltgvpglell
    qrspdregsfyvydvkvddrpafhrkmeaagimaglvsrrndehscvahlrtslpgldsv
    ydrmvslpvgwwlteqdrehvvatirsgw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xauD (D:)
    sglvprgshmiplfkvavsptaldrvaevfasgylgqgprvaefesalaarlgnprvvsv
    hsgtsglclalrlldapeerdevlstpltfeatnwailadgrritwvdvdpatltmdldd
    lerkispatraiivvhwtgypvdldrlagildraerehgfrpaviedcahawgasyrgvp
    lgshgnmcvfsfqalkhltcgdgglltlpgdelheramlrrfygidrtadrlrgaydvae
    wglkwhmtdlnaaiglanletvdeqlrlhrenaafydkeltgvpglellqrspdregsfy
    vydvkvddrpafhrkmeaagimaglvsrrndehscvahlrtslpgldsvydrmvslpvgw
    wlteqdrehvvatirsgw
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4xauE (E:)
    mgsshhhhhhssglvprgshmiplfkvavsptaldrvaevfasgylgqgprvaefesala
    arlgnprvvsvhsgtsglclalrlldapeerdevlstpltfeatnwailadgrritwvdv
    dpatltmdlddlerkispatraiivvhwtgypvdldrlagildraerehgfrpaviedca
    hawgasyrgvplgshgnmcvfsfqalkhltcgdgglltlpgdelheramlrrfygidrta
    drlrgaydvaewglkwhmtdlnaaiglanletvdeqlrlhrenaafydkeltgvpglell
    qrspdregsfyvydvkvddrpafhrkmeaagimaglvsrrndehscvahlrtslpgldsv
    ydrmvslpvgwwlteqdrehvvatirsgw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xauE (E:)
    rgshmiplfkvavsptaldrvaevfasgylgqgprvaefesalaarlgnprvvsvhsgts
    glclalrlldapeerdevlstpltfeatnwailadgrritwvdvdpatltmdlddlerki
    spatraiivvhwtgypvdldrlagildraerehgfrpaviedcahawgasyrgvplgshg
    nmcvfsfqalkhltcgdgglltlpgdelheramlrrfygidrtadrlrgaydvaewglkw
    hmtdlnaaiglanletvdeqlrlhrenaafydkeltgvpglellqrspdregsfyvydvk
    vddrpafhrkmeaagimaglvsrrndehscvahlrtslpgldsvydrmvslpvgwwlteq
    drehvvatirsgw
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4xauF (F:)
    mgsshhhhhhssglvprgshmiplfkvavsptaldrvaevfasgylgqgprvaefesala
    arlgnprvvsvhsgtsglclalrlldapeerdevlstpltfeatnwailadgrritwvdv
    dpatltmdlddlerkispatraiivvhwtgypvdldrlagildraerehgfrpaviedca
    hawgasyrgvplgshgnmcvfsfqalkhltcgdgglltlpgdelheramlrrfygidrta
    drlrgaydvaewglkwhmtdlnaaiglanletvdeqlrlhrenaafydkeltgvpglell
    qrspdregsfyvydvkvddrpafhrkmeaagimaglvsrrndehscvahlrtslpgldsv
    ydrmvslpvgwwlteqdrehvvatirsgw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xauF (F:)
    rgshmiplfkvavsptaldrvaevfasgylgqgprvaefesalaarlgnprvvsvhsgts
    glclalrlldapeerdevlstpltfeatnwailadgrritwvdvdpatltmdlddlerki
    spatraiivvhwtgypvdldrlagildraerehgfrpaviedcahawgasyrgvplgshg
    nmcvfsfqalkhltcgdgglltlpgdelheramlrrfygidrtadrlrgaydvaewglkw
    hmtdlnaaiglanletvdeqlrlhrenaafydkeltgvpglellqrspdregsfyvydvk
    vddrpafhrkmeaagimaglvsrrndehscvahlrtslpgldsvydrmvslpvgwwlteq
    drehvvatirsgw
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4xauG (G:)
    mgsshhhhhhssglvprgshmiplfkvavsptaldrvaevfasgylgqgprvaefesala
    arlgnprvvsvhsgtsglclalrlldapeerdevlstpltfeatnwailadgrritwvdv
    dpatltmdlddlerkispatraiivvhwtgypvdldrlagildraerehgfrpaviedca
    hawgasyrgvplgshgnmcvfsfqalkhltcgdgglltlpgdelheramlrrfygidrta
    drlrgaydvaewglkwhmtdlnaaiglanletvdeqlrlhrenaafydkeltgvpglell
    qrspdregsfyvydvkvddrpafhrkmeaagimaglvsrrndehscvahlrtslpgldsv
    ydrmvslpvgwwlteqdrehvvatirsgw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xauG (G:)
    rgshmiplfkvavsptaldrvaevfasgylgqgprvaefesalaarlgnprvvsvhsgts
    glclalrlldapeerdevlstpltfeatnwailadgrritwvdvdpatltmdlddlerki
    spatraiivvhwtgypvdldrlagildraerehgfrpaviedcahawgasyrgvplgshg
    nmcvfsfqalkhltcgdgglltlpgdelheramlrrfygidrtadrlrgaydvaewglkw
    hmtdlnaaiglanletvdeqlrlhrenaafydkeltgvpglellqrspdregsfyvydvk
    vddrpafhrkmeaagimaglvsrrndehscvahlrtslpgldsvydrmvslpvgwwlteq
    drehvvatirsgw