PDB entry 4xar

View 4xar on RCSB PDB site
Description: mGluR2 ECD and mGluR3 ECD complex with ligands
Class: signaling protein
Keywords: mGluR2 mGluR3 ECD, SIGNALING PROTEIN
Deposited on 2014-12-15, released 2015-02-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Metabotropic glutamate receptor 3
    Species: Homo sapiens [TaxId:9606]
    Gene: GRM3, GPRC1C, MGLUR3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14832 (Start-509)
      • engineered mutation (241)
      • engineered mutation (509)
    Domains in SCOPe 2.07: d4xara_
  • Heterogens: 40F, IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xarA (A:)
    malkmltrlqvltlalfskgfllslgdhnflrreikiegdlvlgglfpinekgtgteecg
    rinedrgiqrleamlfaideinkddyllpgvklgvhildtcsrdtyaleqslefvraslt
    kvdeaeymcpdgsyaiqeniplliagviggsyssvsiqvanllrlfqipqisyastsakl
    sdksrydyfartvppdfyqakamaeilrffnwtyvstvasegdygetgieafeqearlrn
    isiataekvgrsnirksydsvirellqkpnarvvvlfmrsddsreliaaasranasftwv
    asdgwgaqesiikgsehvaygaitlelasqpvrqfdryfqslnpynnhrnpwfrdfweqk
    fqcslqnkrnhrrvcdkhlaidssnyeqeskimfvvnavyamahalhkmqrtlcpnttkl
    cdamkildgkklykdyllkinftapfnpnkdadsivkfdtfgdgmgrynvfnfqnvggky
    sylkvghwaetlsldvnsihwsrnsvptseghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xarA (A:)
    rreikiegdlvlgglfpinekgtgteecgrinedrgiqrleamlfaideinkddyllpgv
    klgvhildtcsrdtyaleqslefvrasllliagviggsyssvsiqvanllrlfqipqisy
    astsaklsdksrydyfartvppdfyqakamaeilrffnwtyvstvasegdygetgieafe
    qearlrnisiataekvgrsnirksydsvirellqkpnarvvvlfmrsddsreliaaasra
    nasftwvasdgwgaqesiikgsehvaygaitlelasqpvrqfdryfqslnpynnhrnpwf
    rdfweqkfqcslrvcdkhlaidssnyeqeskimfvvnavyamahalhkmqrtlcpnttkl
    cdamkildgkklykdyllkinftapdadsivkfdtfgdgmgrynvfnfqnvggkysylkv
    ghwaetlsldvnsihwsrnsvptse