PDB entry 4x98

View 4x98 on RCSB PDB site
Description: Immunoglobulin Fc heterodimer variant
Class: immune system
Keywords: bispecific antibody, immunoglobulin Fc heterodimer, CH3 domain interface, asymmetric disulfide bonds, thermal stability, Fc engineering, IMMUNE SYSTEM
Deposited on 2014-12-11, released 2015-06-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-06-03, with a file datestamp of 2015-05-29.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857 (Start-219)
      • engineered mutation (135)
      • engineered mutation (184)
    Domains in SCOPe 2.06: d4x98a1, d4x98a2
  • Chain 'B':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857 (0-206)
      • engineered mutation (109)
      • engineered mutation (161)
      • engineered mutation (167)
    Domains in SCOPe 2.06: d4x98b1, d4x98b2
  • Heterogens: NAG, FUC, BMA, MAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4x98A (A:)
    tcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvev
    hnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqpr
    epqvytlppsrdeltenqvsltclvkgfypsdiavewesngqpennykttppvldsdgsf
    flyswltvdksrwqqgnvfscsvmhealhnhytqkslsls
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x98A (A:)
    gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
    nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsrd
    eltenqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyswltvdksr
    wqqgnvfscsvmhealhnhytqkslsls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4x98B (B:)
    psvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqyn
    styrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqpreprvytlppsrde
    ltknqvsltclvkgfypsdiavewesngqpennykttppvlvsdgsftlyskltvdksrw
    qqgnvfscsvmhealhnhytqkslsls
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x98B (B:)
    psvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqyn
    rvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqpreprvytlppsrdeltk
    nqvsltclvkgfypsdiavewesngqpennykttppvlvsdgsftlyskltvdksrwqqg
    nvfscsvmhealhnhytqkslsls