PDB entry 4x8j

View 4x8j on RCSB PDB site
Description: Crystal Structure of murine 12F4 Fab monoclonal antibody against ADAMTS5
Class: immune system
Keywords: monoclonal, IMMUNE SYSTEM
Deposited on 2014-12-10, released 2015-04-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-08-05, with a file datestamp of 2015-07-31.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 12F4 FAB Heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4X8J (0-End)
  • Chain 'B':
    Compound: 12F4 FAB Light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4X8J (0-213)
    Domains in SCOPe 2.07: d4x8jb1, d4x8jb2
  • Chain 'H':
    Compound: 12F4 FAB Heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4X8J (0-217)
  • Chain 'L':
    Compound: 12F4 FAB Light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4X8J (0-213)
    Domains in SCOPe 2.07: d4x8jl1, d4x8jl2
  • Heterogens: ZN, 2PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4x8jB (B:)
    divmtqsqkfmsvtvgdrvsitcktsqsvgttivwyqqkpgqspklliysasnrhtgvpd
    rftgsgsgtdfiltinnvqsedladyfcqqytsypftfgsgtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4x8jL (L:)
    divmtqsqkfmsvtvgdrvsitcktsqsvgttivwyqqkpgqspklliysasnrhtgvpd
    rftgsgsgtdfiltinnvqsedladyfcqqytsypftfgsgtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec