PDB entry 4x6r

View 4x6r on RCSB PDB site
Description: An Isoform-specific Myristylation Switch Targets RIIb PKA Holoenzymes to Membranes
Class: transferase
Keywords: PKA, membrane binding, molecular switch, TRANSFERASE
Deposited on 2014-12-09, released 2015-07-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-09-16, with a file datestamp of 2015-09-11.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-dependent protein kinase catalytic subunit alpha
    Species: Mus musculus [TaxId:10090]
    Gene: Prkaca, Pkaca
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05132 (0-349)
      • engineered mutation (6)
    Domains in SCOPe 2.06: d4x6ra_
  • Chain 'B':
    Compound: cAMP-dependent protein kinase type I-alpha regulatory subunit
    Species: Bos taurus [TaxId:9913]
    Gene: PRKAR1A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00514 (0-289)
      • engineered mutation (243)
  • Heterogens: SO4, ATP, TAM, GOL, MYR, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4x6rA (A:)
gnaaaackgseqesvkeflakakedflkkwetpsqntaqldqfdriktlgtgsfgrvmlv
khkesgnhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvm
eyvaggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyi
qvtdfgfakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffa
dqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfatt
dwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkeftef

  • Chain 'B':
    No sequence available.