PDB entry 4x6n

View 4x6n on RCSB PDB site
Description: FACTOR XIA IN COMPLEX WITH THE INHIBITOR 1-{(1S)-1-[4-(3-amino-1H-indazol-6-yl)-5-chloro-1H-imidazol-2-yl]-2-phenylethyl}-3-[5-chloro-2-(1H-tetrazol-1-yl)benzyl]urea
Class: hydrolase/hydrolase inhibitor
Keywords: SERINE PROTEASE, BLOOD COAGULATION FACTOR, PROTEIN INHIBITOR COMPLEX, hydrolase-hydrolase inhibitor complex
Deposited on 2014-12-08, released 2015-02-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-01, with a file datestamp of 2015-03-27.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: coagulation factor xi, light chain
    Species: Homo sapiens [TaxId:9606]
    Gene: F11
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03951 (0-237)
      • engineered mutation (103)
      • engineered mutation (105)
    Domains in SCOPe 2.07: d4x6na_
  • Chain 'H':
    Compound: cleaved peptide
    Species: Homo sapiens [TaxId:9606]
    Gene: F11
    Database cross-references and differences (RAF-indexed):
    • PDB 4X6N
  • Heterogens: 3Y5, SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4x6nA (A:)
    ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
    ilnqseikedtsffgvqeiiihdqykmaesgydiallklettvgygdsqrpiclpskgdr
    nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
    kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqavhh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x6nA (A:)
    ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
    ilnqseikedtsffgvqeiiihdqykmaesgydiallklettvgygdsqrpiclpskgdr
    nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
    kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqav
    

  • Chain 'H':
    No sequence available.