PDB entry 4x6j

View 4x6j on RCSB PDB site
Description: Development of N-(Functionalized benzoyl)-homocycloleucyl-glycinonitriles as Potent Cathepsin K Inhibitors.
Class: hydrolase
Keywords: cathepsin K, inhibitor, HYDROLASE
Deposited on 2014-12-08, released 2015-09-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-09-23, with a file datestamp of 2015-09-18.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cathepsin k
    Species: Homo sapiens [TaxId:9606]
    Gene: CTSK, CTSO, CTSO2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4x6ja_
  • Heterogens: GOL, CL, K, PGO, 3Y2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4x6jA (A:)
apdsvdyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlspqnlvdcvsen
dgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegneka
lkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhwii
knswgenwgnkgyilmarnknnacgianlasfpkm