PDB entry 4x6b

View 4x6b on RCSB PDB site
Description: BK6 TCR apo structure
Class: immune system
Keywords: T cell receptor, CD1a, Autoimmunity, lipid antigen, immune system
Deposited on 2014-12-08, released 2015-01-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-03-04, with a file datestamp of 2015-02-27.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tcr alpha
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4X6B
    Domains in SCOPe 2.07: d4x6ba1, d4x6ba2
  • Chain 'B':
    Compound: tcr beta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4X6B (0-End)
    Domains in SCOPe 2.07: d4x6bb1, d4x6bb2
  • Chain 'C':
    Compound: tcr alpha
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4X6B
    Domains in SCOPe 2.07: d4x6bc1, d4x6bc2
  • Chain 'D':
    Compound: tcr beta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4X6B
    Domains in SCOPe 2.07: d4x6bd1, d4x6bd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4x6bA (A:)
    qkeveqdpgplsvpegaivslnctysnsafqyfmwyrqysrkgpellmytyssgnkedgr
    ftaqvdksskyislfirdsqpsdsatylcamstslpnagkstfgdgttltvkpniqnpdp
    avyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsn
    ksdfacanafnnsiipedtffpspess
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x6bA (A:)
    eveqdpgplsvpegaivslnctysnsafqyfmwyrqysrkgpellmytyssgnkedgrft
    aqvdksskyislfirdsqpsdsatylcamstslpnagkstfgdgttltvkpniqnpdpav
    yqlrdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksdfaca
    nafnnsiipedtffps
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4x6bB (B:)
    nagvtqtpkfrvlktgqsmtllcaqdmnheymywyrqdpgmglrlihysvgegttakgev
    pdgynvsrlkkqnfllglesaapsqtsvyfcasryflptqgmgaffgqgtrltvvedlnk
    vfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplke
    qpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaea
    wgrad
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x6bB (B:)
    nagvtqtpkfrvlktgqsmtllcaqdmnheymywyrqdpgmglrlihysvgegttakgev
    pdgynvsrlkkqnfllglesaapsqtsvyfcasryflptqgmgaffgqgtrltvvedlnk
    vfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplke
    qpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaea
    wgra
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4x6bC (C:)
    qkeveqdpgplsvpegaivslnctysnsafqyfmwyrqysrkgpellmytyssgnkedgr
    ftaqvdksskyislfirdsqpsdsatylcamstslpnagkstfgdgttltvkpniqnpdp
    avyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsn
    ksdfacanafnnsiipedtffpspess
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x6bC (C:)
    eveqdpgplsvpegaivslnctysnsafqyfmwyrqysrkgpellmytyssgnkedgrft
    aqvdksskyislfirdsqpsdsatylcamstslpnagkstfgdgttltvkpniqnpdpav
    yqlrdsvclftdfdsqtnvsqskdsdvyitdkcvldmsnsavawsdfacanafnnsiipe
    dtffps
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4x6bD (D:)
    nagvtqtpkfrvlktgqsmtllcaqdmnheymywyrqdpgmglrlihysvgegttakgev
    pdgynvsrlkkqnfllglesaapsqtsvyfcasryflptqgmgaffgqgtrltvvedlnk
    vfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplke
    qpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaea
    wgrad
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x6bD (D:)
    gvtqtpkfrvlktgqsmtllcaqdmnheymywyrqdpgmglrlihysvgegttakgevpd
    gynvsrlkkqnfllglesaapsqtsvyfcasryflpgmgaffgqgtrltvvedlnkvfpp
    evavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpal
    ndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgra