PDB entry 4x5z

View 4x5z on RCSB PDB site
Description: menin in complex with MI-136
Class: protein binding/inhibitor
Keywords: protein binding-inhibitor complex
Deposited on 2014-12-06, released 2015-04-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Menin
    Species: Homo sapiens [TaxId:9606]
    Gene: MEN1, SCG2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00255 (Start-431)
      • linker (400-431)
    • Uniprot O00255
    Domains in SCOPe 2.07: d4x5za1, d4x5za2
  • Heterogens: SO4, 3XY, PG4, DMS, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4x5zA (A:)
    ggsssmglkaaqktlfplrsiddvvrlfaaelgreepdlvllslvlgfvehflavnrvgl
    tyfpvadlsiiaalyarftaqirgavdlslypreggvssrelvkkvsdviwnslsrsyfk
    drahiqslfsfitgtkldssgvafavvgacqalglrdvhlalsedhawvvfgpngeqtae
    vtwhgkgnedrrgqtvnagvaerswlylkgsymrcdrkmevafmvcainpsidlhtdsle
    llqlqqkllwllydlghlerypmalgnladleeleptpgrpdpltlyhkgiasaktyyrd
    ehiypymylagyhcrnrnvrealqawadtatviqdynycredeeiykeffevandvipnl
    lkeaaslleagsqgsalqdpecfahllrfydgickweegsptpvlhvgwatflvqslgrf
    egqvrqkvrivsvpapaaspppegpvltfqsekmkgmkellvatkinssaiklqltaqsq
    vqmkkqkvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x5zA (A:)
    glkaaqktlfplrsiddvvrlfaaelgreepdlvllslvlgfvehflavnrvgltyfpva
    dlsiiaalyarftaqirgavdlslypreggvssrelvkkvsdviwnslsrsyfkdrahiq
    slfsfitgtkldssgvafavvgacqalglrdvhlalsedhawvvfgpngeqtaevtwhgk
    gnedrrgqtvnagvaerswlylkgsymrcdrkmevafmvcainpsidlhtdslellqlqq
    kllwllydlghlerypmalgnladleeleptpgrpdpltlyhkgiasaktyyrdehiypy
    mylagyhcrnrnvrealqawadtatviqdynycredeeiykeffevandvipnllkeaas
    lleagsqgsalqdpecfahllrfydgickweegsptpvlhvgwatflvqslgrfegqvrq
    kvrivspvltfqsekmkgmkellvatkinssaiklqltaqsqvqmk