PDB entry 4x5q

View 4x5q on RCSB PDB site
Description: Crystal structure of FimH in complex with 5-nitro-indolinylphenyl alpha-D-mannopyranoside
Class: sugar binding protein
Keywords: Sugar Binding Protein, Bacterial Adhesin, Pilus, UPEC, Antagonist Complex
Deposited on 2014-12-05, released 2015-05-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-05-27, with a file datestamp of 2015-05-22.
Experiment type: XRAY
Resolution: 1.12 Å
R-factor: N/A
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein fimh
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: fimH, b4320, JW4283
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4x5qa_
  • Heterogens: 3XN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4x5qA (A:)
    facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrqtnnynsddfqfvwniyanndvvvptgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x5qA (A:)
    facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrqtnnynsddfqfvwniyanndvvvpt