PDB entry 4x54

View 4x54 on RCSB PDB site
Description: Crystal structure of an oxidoreductase (short chain dehydrogenase/reductase) from Brucella ovis
Class: Oxidoreductase
Keywords: oxidoreductase, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID
Deposited on 2014-12-04, released 2015-02-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-02-25, with a file datestamp of 2015-02-20.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.156
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Oxidoreductase, short chain dehydrogenase/reductase family
    Species: Brucella ovis [TaxId:444178]
    Gene: BOV_0113
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4x54a_
  • Heterogens: MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4x54A (A:)
    mahhhhhhmspdsntdnsrpgvssseiprtdterktlvltgasrgighatvkrfslagwr
    vitcsrqdfsencpwpagpedhikvdlsdpedigkaiaeirrrleangsklhalvnnagi
    spkaeggrrmnsietpmavwrdvfqvnfmapimlarglfkeleaaqgsvvnvtsiagsrv
    hpfagtayatskaalaaltremasdfgpygirvnaiapgeidtailspgtdklveqlpmr
    rlgktsevaetiyflctetssyvtgseihinggqhv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x54A (A:)
    rktlvltgasrgighatvkrfslagwrvitcsrqdgpedhikvdlsdpedigkaiaeirr
    rleangsklhalvnnagispkaeggrrmnsietpmavwrdvfqvnfmapimlarglfkel
    eaaqgsvvnvtsiagsrvhpfagtayatskaalaaltremasdfgpygirvnaiapgeid
    tailsgktsevaetiyflctetssyvtgseihin