PDB entry 4x3u

View 4x3u on RCSB PDB site
Description: Crystal structure of chromobox homolog 7 (CBX7) chromodomain with Suramin
Class: transcription
Keywords: CBX7, chromodomain, suramin, TRANSCRIPTION
Deposited on 2014-12-01, released 2015-03-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-03-04, with a file datestamp of 2015-02-27.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chromobox protein homolog 7
    Species: Mus musculus [TaxId:10090]
    Gene: Cbx7, D15Ertd417e
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4x3ua_
  • Chain 'B':
    Compound: Chromobox protein homolog 7
    Species: Mus musculus [TaxId:10090]
    Gene: Cbx7, D15Ertd417e
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4x3ub_
  • Heterogens: SVR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4x3uA (A:)
gshmgeqvfavesirkkrvrkgkveylvkwkgwppkystwepeehildprlvmayeekee
rdra

    Sequence, based on observed residues (ATOM records): (download) 
    >4x3uA (A:)
favesirkkrvrkgkveylvkwkgwppkystwepeehildprlvmayeekeerdra

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >4x3uB (B:)
gshmgeqvfavesirkkrvrkgkveylvkwkgwppkystwepeehildprlvmayeekee
rdra

    Sequence, based on observed residues (ATOM records): (download) 
    >4x3uB (B:)
vfavesirkkrvrkgkveylvkwkgwppkystwepeehildprlvmayeekee