PDB entry 4x3t

View 4x3t on RCSB PDB site
Description: Crystal structure of chromobox homolog 7 (CBX7) chromodomain with MS37452
Class: transcription
Keywords: CBX7, chromodomain, MS37452, inhibitor, TRANSCRIPTION
Deposited on 2014-12-01, released 2015-03-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-03-04, with a file datestamp of 2015-02-27.
Experiment type: XRAY
Resolution: 2.14 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chromobox protein homolog 7
    Species: Mus musculus [TaxId:10090]
    Gene: Cbx7, D15Ertd417e
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8VDS3 (4-63)
      • expression tag (2-3)
    Domains in SCOPe 2.06: d4x3ta1, d4x3ta2
  • Chain 'B':
    Compound: Chromobox protein homolog 7
    Species: Mus musculus [TaxId:10090]
    Gene: Cbx7, D15Ertd417e
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8VDS3 (4-End)
      • expression tag (2-3)
    Domains in SCOPe 2.06: d4x3tb1, d4x3tb2
  • Chain 'C':
    Compound: Chromobox protein homolog 7
    Species: Mus musculus [TaxId:10090]
    Gene: Cbx7, D15Ertd417e
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8VDS3 (4-63)
      • expression tag (2-3)
    Domains in SCOPe 2.06: d4x3tc1, d4x3tc2
  • Chain 'D':
    Compound: Chromobox protein homolog 7
    Species: Mus musculus [TaxId:10090]
    Gene: Cbx7, D15Ertd417e
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8VDS3 (4-63)
      • expression tag (2-3)
    Domains in SCOPe 2.06: d4x3td1, d4x3td2
  • Chain 'E':
    Compound: Chromobox protein homolog 7
    Species: Mus musculus [TaxId:10090]
    Gene: Cbx7, D15Ertd417e
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8VDS3 (4-End)
      • expression tag (2-3)
    Domains in SCOPe 2.06: d4x3te1, d4x3te2
  • Chain 'F':
    Compound: Chromobox protein homolog 7
    Species: Mus musculus [TaxId:10090]
    Gene: Cbx7, D15Ertd417e
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8VDS3 (4-End)
      • expression tag (2-3)
    Domains in SCOPe 2.06: d4x3tf1, d4x3tf2
  • Heterogens: 45E, ZN, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4x3tA (A:)
    gshmgeqvfavesirkkrvrkgkveylvkwkgwppkystwepeehildprlvmayeekee
    rdra
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x3tA (A:)
    hmgeqvfavesirkkrvrkgkveylvkwkgwppkystwepeehildprlvmayeekeerd
    ra
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4x3tB (B:)
    gshmgeqvfavesirkkrvrkgkveylvkwkgwppkystwepeehildprlvmayeekee
    rdra
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x3tB (B:)
    hmgeqvfavesirkkrvrkgkveylvkwkgwppkystwepeehildprlvmayeekeerd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4x3tC (C:)
    gshmgeqvfavesirkkrvrkgkveylvkwkgwppkystwepeehildprlvmayeekee
    rdra
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x3tC (C:)
    hmgeqvfavesirkkrvrkgkveylvkwkgwppkystwepeehildprlvmayeekeerd
    ra
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4x3tD (D:)
    gshmgeqvfavesirkkrvrkgkveylvkwkgwppkystwepeehildprlvmayeekee
    rdra
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x3tD (D:)
    hmgeqvfavesirkkrvrkgkveylvkwkgwppkystwepeehildprlvmayeekeerd
    ra
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4x3tE (E:)
    gshmgeqvfavesirkkrvrkgkveylvkwkgwppkystwepeehildprlvmayeekee
    rdra
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x3tE (E:)
    hmgeqvfavesirkkrvrkgkveylvkwkgwppkystwepeehildprlvm
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4x3tF (F:)
    gshmgeqvfavesirkkrvrkgkveylvkwkgwppkystwepeehildprlvmayeekee
    rdra
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x3tF (F:)
    hmgeqvfavesirkkrvrkgkveylvkwkgwppkystwepeehildprlvmayeek