PDB entry 4x2v

View 4x2v on RCSB PDB site
Description: Crystal structure of the Murine Norovirus NS6 protease (inactive C139A mutant) with a C-terminal extension to include residue P1 prime of NS7
Class: hydrolase
Keywords: Murine norovirus Protease, hydrolase
Deposited on 2014-11-27, released 2015-02-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-03-18, with a file datestamp of 2015-03-13.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ns6 protease
    Species: Murine norovirus 1 [TaxId:223997]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0FJD7 (1-End)
      • engineered mutation (139)
    Domains in SCOPe 2.07: d4x2va_
  • Chain 'B':
    Compound: ns6 protease
    Species: Murine norovirus 1 [TaxId:223997]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0FJD7 (1-184)
      • expression tag (0)
      • engineered mutation (139)
    Domains in SCOPe 2.07: d4x2vb1, d4x2vb2
  • Chain 'C':
    Compound: ns6 protease
    Species: Murine norovirus 1 [TaxId:223997]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0FJD7
      • engineered mutation (139)
    Domains in SCOPe 2.07: d4x2vc_
  • Chain 'D':
    Compound: ns6 protease
    Species: Murine norovirus 1 [TaxId:223997]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0FJD7
      • engineered mutation (139)
    Domains in SCOPe 2.07: d4x2vd_
  • Chain 'E':
    Compound: ns6 protease
    Species: Murine norovirus 1 [TaxId:223997]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: ns6 protease
    Species: MURINE NOROVIRUS 1 [TaxId:223997]
    Database cross-references and differences (RAF-indexed):
    • PDB 4X2V (0-6)
  • Heterogens: IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4x2vA (A:)
    sapvsiwsrvvqfgtgwgfwvsghvfitakhvappkgteifgrkpgdftvtssgdflkyy
    ftsavrpdipamvlengcqegvvasvlvkrasgemlalavrmgsqaaikigsavvhgqtg
    mlltgsnakaqdlgtipgdagcpyvykkgntwvvigvhvaatrsgntviaathgeptlea
    lefqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x2vA (A:)
    apvsiwsrvvqfgtgwgfwvsghvfitakhvappkgteifgrkpgdftvtssgdflkyyf
    tsavrpdipamvlengcqegvvasvlvkrasgemlalavrmgsqaaikigsavvhgqtgm
    lltgsnakaqdlgtipgdagcpyvykkgntwvvigvhvaatrsgntviaathge
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4x2vB (B:)
    sapvsiwsrvvqfgtgwgfwvsghvfitakhvappkgteifgrkpgdftvtssgdflkyy
    ftsavrpdipamvlengcqegvvasvlvkrasgemlalavrmgsqaaikigsavvhgqtg
    mlltgsnakaqdlgtipgdagcpyvykkgntwvvigvhvaatrsgntviaathgeptlea
    lefqg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4x2vC (C:)
    sapvsiwsrvvqfgtgwgfwvsghvfitakhvappkgteifgrkpgdftvtssgdflkyy
    ftsavrpdipamvlengcqegvvasvlvkrasgemlalavrmgsqaaikigsavvhgqtg
    mlltgsnakaqdlgtipgdagcpyvykkgntwvvigvhvaatrsgntviaathgeptlea
    lefqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x2vC (C:)
    vsiwsrvvqfgtgwgfwvsghvfitakhvappkgteifgrkpgdftvtssgdflkyyfts
    avrpdipamvlengcqegvvasvlvkrasgemlalavrmgsqaaikigsavvhgqtgmll
    tgsnakaqdlgtipgdagcpyvykkgntwvvigvhvaatrsgntviaathge
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4x2vD (D:)
    sapvsiwsrvvqfgtgwgfwvsghvfitakhvappkgteifgrkpgdftvtssgdflkyy
    ftsavrpdipamvlengcqegvvasvlvkrasgemlalavrmgsqaaikigsavvhgqtg
    mlltgsnakaqdlgtipgdagcpyvykkgntwvvigvhvaatrsgntviaathgeptlea
    lefqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x2vD (D:)
    vsiwsrvvqfgtgwgfwvsghvfitakhvappkgteifgrkpgdftvtssgdflkyyfts
    avrpdipamvlengcqegvvasvlvkrasgemlalavrmgsqaaikigsavvhgqtgmll
    tgsnakaqdlgtipgdagcpyvykkgntwvvigvhvaatrsgntviaathg
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.