PDB entry 4x1g

View 4x1g on RCSB PDB site
Description: Crystal structure of the hPXR-LBD in complex with the synthetic estrogen 17alpha-ethinylestradiol and the pesticide trans-nonachlor
Class: gene regulation
Keywords: HORMONE RECEPTOR, ESTROGEN, PESTICIDE, gene regulation
Deposited on 2014-11-24, released 2015-09-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-09-16, with a file datestamp of 2015-09-11.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor subfamily 1 group I member 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NR1I2, PXR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4x1ga_
  • Heterogens: 3WF, 3WG, MPD, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4x1gA (A:)
    mkkghhhhhhgsertgtqplgvqglteeqrmmirelmdaqmktfdttfshfknfrlpgvl
    ssgcelpeslqapsreeaakwsqvrkdlcslkvslqlrgedgsvwnykppadsggkeifs
    llphmadmstymfkgiisfakvisyfrdlpiedqisllkgaafelcqlrfntvfnaetgt
    wecgrlsycledtaggfqqlllepmlkfhymlkklqlheeeyvlmqaislfspdrpgvlq
    hrvvdqlqeqfaitlksyiecnrpqpahrflflkimamltelrsinaqhtqrllriqdih
    pfatplmqelfgitgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x1gA (A:)
    glteeqrmmirelmdaqmktfdttfshfknfrlpgvsreeaakwsqvrkdlcslkvslql
    rgedgsvwnykppadsggkeifsllphmadmstymfkgiisfakvisyfrdlpiedqisl
    lkgaafelcqlrfntvfnaetgtwecgrlsycledtaggfqqlllepmlkfhymlkklql
    heeeyvlmqaislfspdrpgvlqhrvvdqlqeqfaitlksyiecnrpqpahrflflkima
    mltelrsinaqhtqrllriqdihpfatplmqelfgitgs