PDB entry 4x13

View 4x13 on RCSB PDB site
Description: JC Polyomavirus genotype 3 VP1 in complex with LSTc pentasaccharide
Class: viral protein
Keywords: beta-sandwich, jelly-roll, viral major capsid protein, glycan, viral protein
Deposited on 2014-11-24, released 2015-04-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-05-27, with a file datestamp of 2015-05-22.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Major capsid protein
    Species: JC polyomavirus type 3 [TaxId:804310]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4x13a_
  • Chain 'B':
    Compound: Major capsid protein
    Species: JC polyomavirus type 3 [TaxId:804310]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4x13b_
  • Chain 'C':
    Compound: Major capsid protein
    Species: JC polyomavirus type 3 [TaxId:804310]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4x13c_
  • Chain 'D':
    Compound: Major capsid protein
    Species: JC polyomavirus type 3 [TaxId:804310]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4x13d_
  • Chain 'E':
    Compound: Major capsid protein
    Species: JC polyomavirus type 3 [TaxId:804310]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4x13e_
  • Heterogens: GOL, EDO, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4x13A (A:)
    gshmggvevlevktgvdsitevecfltpemgdpdehlrgfsksisisdtfesdspnkdml
    pcysvariplpnlnedltcgnilmweavtlktevigvttlmnvhsngqathdngaakpvq
    gtsfhffsvggealelqgvvfnyrttypdgtifpknatvqsqvmntehkayldknkaypv
    ecwvpdptrnentryfgtltggenvppvlhitntattvlldefgvgplckgdnlylsavd
    vcgmftnrsgsqqwrglsryfkvqlrkrrvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x13A (A:)
    vevlevktgvdsitevecfltpemgdpdehlrgfsksisisdtfesdspnkdmlpcysva
    riplpnlnilmweavtlktevigvttlmnvhsngqathdngaakpvqgtsfhffsvggea
    lelqgvvfnyrttypdgtifpknatvqsqvmntehkayldknkaypvecwvpdptrnent
    ryfgtltggenvppvlhitntattvlldefgvgplckgdnlylsavdvcgmftnrsgsqq
    wrglsryfkvqlrkrrvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4x13B (B:)
    gshmggvevlevktgvdsitevecfltpemgdpdehlrgfsksisisdtfesdspnkdml
    pcysvariplpnlnedltcgnilmweavtlktevigvttlmnvhsngqathdngaakpvq
    gtsfhffsvggealelqgvvfnyrttypdgtifpknatvqsqvmntehkayldknkaypv
    ecwvpdptrnentryfgtltggenvppvlhitntattvlldefgvgplckgdnlylsavd
    vcgmftnrsgsqqwrglsryfkvqlrkrrvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x13B (B:)
    evlevktgvdsitevecfltpemgdpdehlrgfsksisisdtfesdspnkdmlpcysvar
    iplpnlilmweavtlktevigvttlmnvhsngqathdngaakpvqgtsfhffsvggeale
    lqgvvfnyrttypdgtifpknatvqsqvmntehkayldknkaypvecwvpdptrnentry
    fgtltggenvppvlhitntattvlldefgvgplckgdnlylsavdvcgmftnrsgsqqwr
    glsryfkvqlrkrrvk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4x13C (C:)
    gshmggvevlevktgvdsitevecfltpemgdpdehlrgfsksisisdtfesdspnkdml
    pcysvariplpnlnedltcgnilmweavtlktevigvttlmnvhsngqathdngaakpvq
    gtsfhffsvggealelqgvvfnyrttypdgtifpknatvqsqvmntehkayldknkaypv
    ecwvpdptrnentryfgtltggenvppvlhitntattvlldefgvgplckgdnlylsavd
    vcgmftnrsgsqqwrglsryfkvqlrkrrvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x13C (C:)
    vevlevktgvdsitevecfltpemgdpdehlrgfsksisisdtfesdspnkdmlpcysva
    riplpnlilmweavtlktevigvttlmnvhsngqathdngaakpvqgtsfhffsvggeal
    elqgvvfnyrttypdgtifpknatvqsqvmntehkayldknkaypvecwvpdptrnentr
    yfgtltggenvppvlhitntattvlldefgvgplckgdnlylsavdvcgmftnrsgsqqw
    rglsryfkvqlrkrrvk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4x13D (D:)
    gshmggvevlevktgvdsitevecfltpemgdpdehlrgfsksisisdtfesdspnkdml
    pcysvariplpnlnedltcgnilmweavtlktevigvttlmnvhsngqathdngaakpvq
    gtsfhffsvggealelqgvvfnyrttypdgtifpknatvqsqvmntehkayldknkaypv
    ecwvpdptrnentryfgtltggenvppvlhitntattvlldefgvgplckgdnlylsavd
    vcgmftnrsgsqqwrglsryfkvqlrkrrvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x13D (D:)
    evlevktgvdsitevecfltpemgdpdehlrgfsksisisdtfesdspnkdmlpcysvar
    iplpnlilmweavtlktevigvttlmnvhsngqathdngaakpvqgtsfhffsvggeale
    lqgvvfnyrttypdgtifpknatvqsqvmntehkayldknkaypvecwvpdptrnentry
    fgtltggenvppvlhitntattvlldefgvgplckgdnlylsavdvcgmftnrsgsqqwr
    glsryfkvqlrkrrvk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4x13E (E:)
    gshmggvevlevktgvdsitevecfltpemgdpdehlrgfsksisisdtfesdspnkdml
    pcysvariplpnlnedltcgnilmweavtlktevigvttlmnvhsngqathdngaakpvq
    gtsfhffsvggealelqgvvfnyrttypdgtifpknatvqsqvmntehkayldknkaypv
    ecwvpdptrnentryfgtltggenvppvlhitntattvlldefgvgplckgdnlylsavd
    vcgmftnrsgsqqwrglsryfkvqlrkrrvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x13E (E:)
    vevlevktgvdsitevecfltpemgdpdehlrgfsksisisdtfesdspnkdmlpcysva
    riplpnlnilmweavtlktevigvttlmnvhsngqathdngaakpvqgtsfhffsvggea
    lelqgvvfnyrttypdgtifpknatvqsqvmntehkayldknkaypvecwvpdptrnent
    ryfgtltggenvppvlhitntattvlldefgvgplckgdnlylsavdvcgmftnrsgsqq
    wrglsryfkvqlrkrrvk