PDB entry 4x0y

View 4x0y on RCSB PDB site
Description: JC polyomavirus VP1 from a genotype 3 strain
Class: viral protein
Keywords: beta-sandwich, jelly-roll, viral capsid protein, viral protein
Deposited on 2014-11-24, released 2015-04-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-05-27, with a file datestamp of 2015-05-22.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Major capsid protein
    Species: JC polyomavirus type 3 [TaxId:804310]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4x0ya_
  • Chain 'B':
    Compound: Major capsid protein
    Species: JC polyomavirus type 3 [TaxId:804310]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4x0yb_
  • Chain 'C':
    Compound: Major capsid protein
    Species: JC polyomavirus type 3 [TaxId:804310]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4x0yc_
  • Chain 'D':
    Compound: Major capsid protein
    Species: JC polyomavirus type 3 [TaxId:804310]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4x0yd_
  • Chain 'E':
    Compound: Major capsid protein
    Species: JC polyomavirus type 3 [TaxId:804310]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4x0ye_
  • Heterogens: GOL, EDO, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4x0yA (A:)
    gshmggvevlevktgvdsitevecfltpemgdpdehlrgfsksisisdtfesdspnkdml
    pcysvariplpnlnedltcgnilmweavtlktevigvttlmnvhsngqathdngaakpvq
    gtsfhffsvggealelqgvvfnyrttypdgtifpknatvqsqvmntehkayldknkaypv
    ecwvpdptrnentryfgtltggenvppvlhitntattvlldefgvgplckgdnlylsavd
    vcgmftnrsgsqqwrglsryfkvqlrkrrvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x0yA (A:)
    vevlevktgvdsitevecfltpemgdpdehlrgfsksisisdtfesdspnkdmlpcysva
    riplpnlnilmweavtlktevigvttlmnvhsngqathdngaakpvqgtsfhffsvggea
    lelqgvvfnyrttypdgtifpknatvqsqvmntehkayldknkaypvecwvpdptrnent
    ryfgtltggenvppvlhitntattvlldefgvgplckgdnlylsavdvcgmftnrsgsqq
    wrglsryfkvqlrkrrvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4x0yB (B:)
    gshmggvevlevktgvdsitevecfltpemgdpdehlrgfsksisisdtfesdspnkdml
    pcysvariplpnlnedltcgnilmweavtlktevigvttlmnvhsngqathdngaakpvq
    gtsfhffsvggealelqgvvfnyrttypdgtifpknatvqsqvmntehkayldknkaypv
    ecwvpdptrnentryfgtltggenvppvlhitntattvlldefgvgplckgdnlylsavd
    vcgmftnrsgsqqwrglsryfkvqlrkrrvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x0yB (B:)
    evlevktgvdsitevecfltpemgdpdehlrgfsksisisdtfesdspnkdmlpcysvar
    iplpnlnilmweavtlktevigvttlmnvhsngqathdngaakpvqgtsfhffsvggeal
    elqgvvfnyrttypdgtifpknatvqsqvmntehkayldknkaypvecwvpdptrnentr
    yfgtltggenvppvlhitntattvlldefgvgplckgdnlylsavdvcgmftnrsgsqqw
    rglsryfkvqlrkrrvk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4x0yC (C:)
    gshmggvevlevktgvdsitevecfltpemgdpdehlrgfsksisisdtfesdspnkdml
    pcysvariplpnlnedltcgnilmweavtlktevigvttlmnvhsngqathdngaakpvq
    gtsfhffsvggealelqgvvfnyrttypdgtifpknatvqsqvmntehkayldknkaypv
    ecwvpdptrnentryfgtltggenvppvlhitntattvlldefgvgplckgdnlylsavd
    vcgmftnrsgsqqwrglsryfkvqlrkrrvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x0yC (C:)
    evlevktgvdsitevecfltpemgdpdehlrgfsksisisdtfesdspnkdmlpcysvar
    iplpnlnilmweavtlktevigvttlmnvhsngqathdngaakpvqgtsfhffsvggeal
    elqgvvfnyrttypdgtifpknatvqsqvmntehkayldknkaypvecwvpdptrnentr
    yfgtltggenvppvlhitntattvlldefgvgplckgdnlylsavdvcgmftnrsgsqqw
    rglsryfkvqlrkrrvk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4x0yD (D:)
    gshmggvevlevktgvdsitevecfltpemgdpdehlrgfsksisisdtfesdspnkdml
    pcysvariplpnlnedltcgnilmweavtlktevigvttlmnvhsngqathdngaakpvq
    gtsfhffsvggealelqgvvfnyrttypdgtifpknatvqsqvmntehkayldknkaypv
    ecwvpdptrnentryfgtltggenvppvlhitntattvlldefgvgplckgdnlylsavd
    vcgmftnrsgsqqwrglsryfkvqlrkrrvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x0yD (D:)
    evlevktgvdsitevecfltpemgdpdehlrgfsksisisdtfesdspnkdmlpcysvar
    iplpnlnilmweavtlktevigvttlmnvhsngqathdngaakpvqgtsfhffsvggeal
    elqgvvfnyrttypdgtifpknatvqsqvmntehkayldknkaypvecwvpdptrnentr
    yfgtltggenvppvlhitntattvlldefgvgplckgdnlylsavdvcgmftnrsgsqqw
    rglsryfkvqlrkrrvk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4x0yE (E:)
    gshmggvevlevktgvdsitevecfltpemgdpdehlrgfsksisisdtfesdspnkdml
    pcysvariplpnlnedltcgnilmweavtlktevigvttlmnvhsngqathdngaakpvq
    gtsfhffsvggealelqgvvfnyrttypdgtifpknatvqsqvmntehkayldknkaypv
    ecwvpdptrnentryfgtltggenvppvlhitntattvlldefgvgplckgdnlylsavd
    vcgmftnrsgsqqwrglsryfkvqlrkrrvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x0yE (E:)
    vevlevktgvdsitevecfltpemgdpdehlrgfsksisisdtfesdspnkdmlpcysva
    riplpnlnnilmweavtlktevigvttlmnvhsngqathdngaakpvqgtsfhffsvgge
    alelqgvvfnyrttypdgtifpknatvqsqvmntehkayldknkaypvecwvpdptrnen
    tryfgtltggenvppvlhitntattvlldefgvgplckgdnlylsavdvcgmftnrsgsq
    qwrglsryfkvqlrkrrvk