PDB entry 4x0m

View 4x0m on RCSB PDB site
Description: Selection of fragments for kinase inhibitor design: decoration is key
Class: transferase
Keywords: transferase, protein kinase, inhibitor complex
Deposited on 2014-11-21, released 2014-12-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-01-21, with a file datestamp of 2015-01-16.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: 0.21
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TGF-beta receptor type-1
    Species: Homo sapiens [TaxId:9606]
    Gene: TGFBR1, ALK5, SKR4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36897 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.06: d4x0ma1, d4x0ma2
  • Heterogens: 3WA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4x0mA (A:)
    gtiartivlqesigkgrfgevwrgkwrgeevavkifssreerswfreaeiyqtvmlrhen
    ilgfiaadnkdngtwtqlwlvsdyhehgslfdylnrytvtvegmiklalstasglahlhm
    eivgtqgkpaiahrdlksknilvkkngtcciadlglavrhdsatdtidiapnhrvgtkry
    mapevlddsinmkhfesfkradiyamglvfweiarrcsiggihedyqlpyydlvpsdpsv
    eemrkvvceqklrpnipnrwqscealrvmakimrecwyangaarltalrikktlsqlsqq
    egikm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x0mA (A:)
    gtiartivlqesigkgrfgevwrgkwrgeevavkifssreerswfreaeiyqtvmlrhen
    ilgfiaadnkdngtwtqlwlvsdyhehgslfdylnrytvtvegmiklalstasglahlhm
    eivgtqgkpaiahrdlksknilvkkngtcciadlglavrhdsatdtidiapnhrvgtkry
    mapevlddsinmkhfesfkradiyamglvfweiarrcsiggihedyqlpyydlvpsdpsv
    eemrkvvceqklrpnipnrwqscealrvmakimrecwyangaarltalrikktlsqlsqq
    egi