PDB entry 4x09

View 4x09 on RCSB PDB site
Description: Structure of human RNase 6 in complex with sulphate anions
Class: hydrolase
Keywords: RNase k6, hydrolase, pancreatic ribonuclease, RNase 7
Deposited on 2014-11-21, released 2016-04-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ribonuclease K6
  Species: Homo sapiens [TaxId:9606]
  Gene: RNASE6, RNS6
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q93091 (1-127)
    • initiating methionine (0)
  Domains in SCOPe 2.08: d4x09a1, d4x09a2
• Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4x09A (A:)
  mwpkrltkahwfeiqhiqpsplqcnramsginnytqhckhqntflhdsfqnvaavcdlls
  ivcknrrhnchqsskpvnmtdcrltsgkypqcrysaaaqykffivacdppqksdppyklv
  pvhldsil