PDB entry 4wzf

View 4wzf on RCSB PDB site
Description: Crystal structural basis for Rv0315, an immunostimulatory antigen and pseudo beta-1, 3-glucanase of Mycobacterium tuberculosis
Class: hydrolase activator
Keywords: Mycobacterium tuberculosis, Rv0315, GH16 laminarinases, beta-1, 3-glucanase, DC maturation, HYDROLASE ACTIVATOR
Deposited on 2014-11-19, released 2015-12-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-12-09, with a file datestamp of 2015-12-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1,3-beta-glucanase
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: Rv0315, RVBD_0315, LH57_01715, P425_00327
    Database cross-references and differences (RAF-indexed):
    • Uniprot O07242 (Start-293)
      • expression tag (294-296)
    Domains in SCOPe 2.06: d4wzfa1, d4wzfa2
  • Chain 'B':
    Compound: 1,3-beta-glucanase
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: Rv0315, RVBD_0315, LH57_01715, P425_00327
    Database cross-references and differences (RAF-indexed):
    • Uniprot O07242 (Start-293)
      • expression tag (294-297)
    Domains in SCOPe 2.06: d4wzfb1, d4wzfb2
  • Heterogens: CA, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4wzfA (A:)
    mlmpemdrrrmmmmagfgalaaalpaptawadpsrpaapagptpapaapaaatggllfhd
    efdgpagsvpdpskwqvsnhrtpiknpvgfdrpqffgqyrdsrqnvfldgnsnlvlratr
    egnryfgglvhglwrggigttwearikfnclapgmwpawwlsnddpgrsgeidliewygn
    gtwpsgttvhanpdgtafetcpigvdggwhnwrvtwnpsgmyfwldyadgiepyfsvpat
    giedlnepirewpfndpgykvfpvlnlavggsgggdpatgsypqemlvdwvrvfgshhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wzfA (A:)
    ggllfhdefdgpagsvpdpskwqvsnhrtpiknpvgfdrpqffgqyrdsrqnvfldgnsn
    lvlratregnryfgglvhglwrggigttwearikfnclapgmwpawwlsnddpgrsgeid
    liewygngtwpsgttvhanpdgtafetcpigvdggwhnwrvtwnpsgmyfwldyadgiep
    yfsvpatgnepirewpfndpgykvfpvlnlavggsgggdpatgsypqemlvdwvrvfgsh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4wzfB (B:)
    mlmpemdrrrmmmmagfgalaaalpaptawadpsrpaapagptpapaapaaatggllfhd
    efdgpagsvpdpskwqvsnhrtpiknpvgfdrpqffgqyrdsrqnvfldgnsnlvlratr
    egnryfgglvhglwrggigttwearikfnclapgmwpawwlsnddpgrsgeidliewygn
    gtwpsgttvhanpdgtafetcpigvdggwhnwrvtwnpsgmyfwldyadgiepyfsvpat
    giedlnepirewpfndpgykvfpvlnlavggsgggdpatgsypqemlvdwvrvfgshhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wzfB (B:)
    ggllfhdefdgpagsvpdpskwqvsnhrtpiknpvgfdrpqffgqyrdsrqnvfldgnsn
    lvlratregnryfgglvhglwrggigttwearikfnclapgmwpawwlsnddpgrsgeid
    liewygngtwpsgttvhanpdgtafetcpigvdggwhnwrvtwnpsgmyfwldyadgiep
    yfsvpatgnepirewpfndpgykvfpvlnlavggsgggdpatgsypqemlvdwvrvfgsh
    h