PDB entry 4wzc

View 4wzc on RCSB PDB site
Description: Understanding Extradiol Dioxygenase Mechanism in NAD+ Biosynthesis by Viewing Catalytic Intermediates - 2,3-cis-4,5-trans ACMS bound to I142A mutant HAO
Class: oxidoreductase
Keywords: bi-cupin iron-binding, dioxygenase, OXIDOREDUCTASE
Deposited on 2014-11-19, released 2016-02-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-09, with a file datestamp of 2017-08-04.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-hydroxyanthranilate 3,4-dioxygenase
    Species: Ralstonia metallidurans [TaxId:266264]
    Gene: nbaC, Rmet_5193
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1LCS4 (3-176)
      • engineered mutation (144)
    Domains in SCOPe 2.07: d4wzca_
  • Heterogens: FE2, 1UC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4wzcA (A:)
    hhhmltygapfnfprwidehahllkppvgnrqvwqdsdfivtvvggpnhrtdyhddplee
    ffyqlrgnaylnlwvdgrreradlkegdifllpphvrhspqrpeagsaclvierqrpagm
    ldgfewycdacghlvhrvevqlksavtdlpplfesfyasedkrrcphcgqvhpgraa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wzcA (A:)
    mltygapfnfprwidehahllkppvgnrqvwqdsdfivtvvggpnhrtdyhddpleeffy
    qlrgnaylnlwvdgrreradlkegdifllpphvrhspqrpeagsaclvierqrpagmldg
    fewycdacghlvhrvevqlksavtdlpplfesfyasedkrrcphcgqvhpgraa