PDB entry 4wz3

View 4wz3 on RCSB PDB site
Description: Crystal structure of the complex between LubX/LegU2/Lpp2887 U-box 1 and Homo sapiens UBE2D2
Class: ligase
Keywords: alpha/beta protein, effector, activating enzyme, structural genomics, PSI-Biology, Midwest Center for Structural Genomics, MCSG, LIGASE
Deposited on 2014-11-18, released 2015-01-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-08-19, with a file datestamp of 2015-08-14.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquitin-conjugating enzyme e2 d2
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2D2, PUBC1, UBC4, UBC5B, UBCH4, UBCH5B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62837 (1-147)
      • expression tag (0)
      • engineered mutation (85)
    Domains in SCOPe 2.06: d4wz3a1, d4wz3a2
  • Chain 'B':
    Compound: E3 ubiquitin-protein ligase LubX
    Species: Legionella pneumophila [TaxId:297246]
    Gene: lubX, lpp2887
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4wz3A (A:)
    gmalkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptd
    ypfkppkvafttriyhpninsngsisldilrsqwspaltiskvllsicsllcdpnpddpl
    vpeiariyktdrekynriarewtqkyam
    

  • Chain 'B':
    No sequence available.