PDB entry 4wyd

View 4wyd on RCSB PDB site
Description: Adenosylmethionine-8-amino-7-oxononanoate aminotransferase from Mycobacterium tuberculosis complexed with a fragment from DSF screening
Class: transferase/transferase inhibitor
Keywords: transaminase PLP Complex Fragment, transferase-transferase inhibitor complex
Deposited on 2014-11-17, released 2015-07-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-07-22, with a file datestamp of 2015-07-17.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adenosylmethionine-8-amino-7-oxononanoate aminotransferase
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: bioA, Rv1568, MTCY336.35c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4wyda_
  • Chain 'B':
    Compound: Adenosylmethionine-8-amino-7-oxononanoate aminotransferase
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: bioA, Rv1568, MTCY336.35c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4wydb_
  • Heterogens: PLP, 3VR, EPE, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4wydA (A:)
    mgsshhhhhhssglvprgshmaaatggltpeqiiavdgahlwhpyssigreavspvvava
    ahgawltlirdgqpievldamsswwtaihghghpaldqalttqlrvmnhvmfgglthepa
    arlakllvditpagldtvffsdsgsvsvevaakmalqywrgrglpgkrrlmtwrggyhgd
    tflamsicdphggmhslwtdvlaaqvfapqvprdydpaysaafeaqlaqhagelaavvve
    pvvqgaggmrfhdprylhdlrdicrryevllifdeiatgfgrtgalfaadhagvspdimc
    vgkaltggylslaatlctadvahtisagaagalmhgptfmanplacavsvasvelllgqd
    wrtritelaagltagldtaralpavtdvrvcgaigviecdrpvdlavatpaaldrgvwlr
    pfrnlvyamppyictpaeitqitsamvevarlvgslp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wydA (A:)
    ltpeqiiavdgahlwhpyssigreavspvvavaahgawltlirdgqpievldamsswwta
    ihghghpaldqalttqlrvmnhvmfgglthepaarlakllvditpagldtvffsdsgsvs
    vevaakmalqywrgrglpgkrrlmtwrggyhgdtflamsicdphggmhslwtdvlaaqvf
    apqvprdydpaysaafeaqlaqhagelaavvvepvvqgaggmrfhdprylhdlrdicrry
    evllifdeiatgfgrtgalfaadhagvspdimcvgkaltggylslaatlctadvahtisa
    gaagalmhgptfmanplacavsvasvelllgqdwrtritelaagltagldtaralpavtd
    vrvcgaigviecdrpvdlavatpaaldrgvwlrpfrnlvyamppyictpaeitqitsamv
    evarlvgslp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4wydB (B:)
    mgsshhhhhhssglvprgshmaaatggltpeqiiavdgahlwhpyssigreavspvvava
    ahgawltlirdgqpievldamsswwtaihghghpaldqalttqlrvmnhvmfgglthepa
    arlakllvditpagldtvffsdsgsvsvevaakmalqywrgrglpgkrrlmtwrggyhgd
    tflamsicdphggmhslwtdvlaaqvfapqvprdydpaysaafeaqlaqhagelaavvve
    pvvqgaggmrfhdprylhdlrdicrryevllifdeiatgfgrtgalfaadhagvspdimc
    vgkaltggylslaatlctadvahtisagaagalmhgptfmanplacavsvasvelllgqd
    wrtritelaagltagldtaralpavtdvrvcgaigviecdrpvdlavatpaaldrgvwlr
    pfrnlvyamppyictpaeitqitsamvevarlvgslp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wydB (B:)
    gltpeqiiavdgahlwhpyssigreavspvvavaahgawltlirdgqpievldamsswwt
    aihghghpaldqalttqlrvmnhvmfgglthepaarlakllvditpagldtvffsdsgsv
    svevaakmalqywrgrglpgkrrlmtwrggyhgdtflamsicdphggmhslwtdvlaaqv
    fapqvprdydpaysaafeaqlaqhagelaavvvepvvqgaggmrfhdprylhdlrdicrr
    yevllifdeiatgfgrtgalfaadhagvspdimcvgkaltggylslaatlctadvahtis
    agaagalmhgptfmanplacavsvasvelllgqdwrtritelaagltagldtaralpavt
    dvrvcgaigviecdrpvdlavatpaaldrgvwlrpfrnlvyamppyictpaeitqitsam
    vevarlvgsl