PDB entry 4wy8

View 4wy8 on RCSB PDB site
Description: Structural analysis of two fungal esterases from Rhizomucor miehei explaining their substrate specificity
Class: hydrolase
Keywords: Rhizomucor miehei, Esterase, Substrate specificity, HYDROLASE
Deposited on 2014-11-16, released 2015-07-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-08-12, with a file datestamp of 2015-08-07.
Experiment type: XRAY
Resolution: 2.27 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: esterase
    Species: Rhizomucor miehei CAU432 [TaxId:1031333]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WY8 (Start-326)
    Domains in SCOPe 2.07: d4wy8a1, d4wy8a2
  • Chain 'B':
    Compound: esterase
    Species: Rhizomucor miehei CAU432 [TaxId:1031333]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WY8
    Domains in SCOPe 2.07: d4wy8b1, d4wy8b2
  • Chain 'C':
    Compound: esterase
    Species: Rhizomucor miehei CAU432 [TaxId:1031333]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WY8
    Domains in SCOPe 2.07: d4wy8c1, d4wy8c2
  • Chain 'D':
    Compound: esterase
    Species: Rhizomucor miehei CAU432 [TaxId:1031333]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WY8
    Domains in SCOPe 2.07: d4wy8d1, d4wy8d2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4wy8A (A:)
    maptvklkpycqniadaatidstqyppevvrkaeaasiiddpkaleglpdvyleektinr
    kngskieltitrpldtenqvlppivffhgggwvvgsklthrrtvyeltvraraavifvny
    slspevrfptaleecldavvwvakeenaksinvdptklvvagdsaggnlsavvcirakql
    glniikgqvliypvtddnfetdsykqfaenyyltrklmvwffdhyipdkkdrqsifacpl
    kasiddlrvlpralvitaeadvlreegeayarklieagndvtavrylgiihgifnlatls
    ptgseildhivawlqktwklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wy8A (A:)
    ptvklkpycqniadaatidstqyppevvrkaeaasiiddpkaleglpdvyleektinrkn
    gskieltitrpldtenqvlppivffhgggwvvgsklthrrtvyeltvraraavifvnysl
    spevrfptaleecldavvwvakeenaksinvdptklvvagdsaggnlsavvcirakqlgl
    niikgqvliypvtddnfetdsykqfaenyyltrklmvwffdhyipdkkdrqsifacplka
    siddlrvlpralvitaeadvlreegeayarklieagndvtavrylgiihgifnlatlspt
    gseildhivawlqktwklehhhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4wy8B (B:)
    maptvklkpycqniadaatidstqyppevvrkaeaasiiddpkaleglpdvyleektinr
    kngskieltitrpldtenqvlppivffhgggwvvgsklthrrtvyeltvraraavifvny
    slspevrfptaleecldavvwvakeenaksinvdptklvvagdsaggnlsavvcirakql
    glniikgqvliypvtddnfetdsykqfaenyyltrklmvwffdhyipdkkdrqsifacpl
    kasiddlrvlpralvitaeadvlreegeayarklieagndvtavrylgiihgifnlatls
    ptgseildhivawlqktwklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wy8B (B:)
    ptvklkpycqniadaatidstqyppevvrkaeaasiiddpkaleglpdvyleektinrkn
    gskieltitrpldtenqvlppivffhgggwvvgsklthrrtvyeltvraraavifvnysl
    spevrfptaleecldavvwvakeenaksinvdptklvvagdsaggnlsavvcirakqlgl
    niikgqvliypvtddnfetdsykqfaenyyltrklmvwffdhyipdkkdrqsifacplka
    siddlrvlpralvitaeadvlreegeayarklieagndvtavrylgiihgifnlatlspt
    gseildhivawlqktwklehhhhh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4wy8C (C:)
    maptvklkpycqniadaatidstqyppevvrkaeaasiiddpkaleglpdvyleektinr
    kngskieltitrpldtenqvlppivffhgggwvvgsklthrrtvyeltvraraavifvny
    slspevrfptaleecldavvwvakeenaksinvdptklvvagdsaggnlsavvcirakql
    glniikgqvliypvtddnfetdsykqfaenyyltrklmvwffdhyipdkkdrqsifacpl
    kasiddlrvlpralvitaeadvlreegeayarklieagndvtavrylgiihgifnlatls
    ptgseildhivawlqktwklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wy8C (C:)
    ptvklkpycqniadaatidstqyppevvrkaeaasiiddpkaleglpdvyleektinrkn
    gskieltitrpldtenqvlppivffhgggwvvgsklthrrtvyeltvraraavifvnysl
    spevrfptaleecldavvwvakeenaksinvdptklvvagdsaggnlsavvcirakqlgl
    niikgqvliypvtddnfetdsykqfaenyyltrklmvwffdhyipdkkdrqsifacplka
    siddlrvlpralvitaeadvlreegeayarklieagndvtavrylgiihgifnlatlspt
    gseildhivawlqktwklehhhh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4wy8D (D:)
    maptvklkpycqniadaatidstqyppevvrkaeaasiiddpkaleglpdvyleektinr
    kngskieltitrpldtenqvlppivffhgggwvvgsklthrrtvyeltvraraavifvny
    slspevrfptaleecldavvwvakeenaksinvdptklvvagdsaggnlsavvcirakql
    glniikgqvliypvtddnfetdsykqfaenyyltrklmvwffdhyipdkkdrqsifacpl
    kasiddlrvlpralvitaeadvlreegeayarklieagndvtavrylgiihgifnlatls
    ptgseildhivawlqktwklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wy8D (D:)
    ptvklkpycqniadaatidstqyppevvrkaeaasiiddpkaleglpdvyleektinrkn
    gskieltitrpldtenqvlppivffhgggwvvgsklthrrtvyeltvraraavifvnysl
    spevrfptaleecldavvwvakeenaksinvdptklvvagdsaggnlsavvcirakqlgl
    niikgqvliypvtddnfetdsykqfaenyyltrklmvwffdhyipdkkdrqsifacplka
    siddlrvlpralvitaeadvlreegeayarklieagndvtavrylgiihgifnlatlspt
    gseildhivawlqktwklehhh