PDB entry 4wy7

View 4wy7 on RCSB PDB site
Description: Crystal structure of recombinant 4E10 expressed in Escherichia coli with epitope bound
Class: immune system
Keywords: broad neutralizing antobody, recombinant Fab, epitope, immune system
Deposited on 2014-11-16, released 2015-03-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-03-25, with a file datestamp of 2015-03-20.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab 4E10 Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WY7
  • Chain 'L':
    Compound: Fab 4E10Light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WY7 (0-End)
    Domains in SCOPe 2.05: d4wy7l1, d4wy7l2
  • Chain 'P':
    Compound: envelope glycoprotein gp160
    Species: Human immunodeficiency virus type 1 group M subtype B [TaxId:11705]
    Gene: ENV
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05880 (0-12)
      • expression tag (13-14)
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download) 
    >4wy7L (L:)
eivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsgva
drfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvevkrtvaapsvfifp
psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
tlskadyekhkvyacevthqglsspvtksfnrge

    Sequence, based on observed residues (ATOM records): (download) 
    >4wy7L (L:)
eivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsgva
drfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvevkrtvaapsvfifp
psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
tlskadyekhkvyacevthqglsspvtksfnr

  • Chain 'P':
    No sequence available.