PDB entry 4wy3

View 4wy3 on RCSB PDB site
Description: Structure of SARS-3CL protease complex with a phenylbenzoyl (R,S)-N-decalin type inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: hydrase proteinase converting, designed inhibitor, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2014-11-15, released 2015-02-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-05, with a file datestamp of 2020-01-31.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3C-like proteinase
    Species: SARS coronavirus [TaxId:227859]
    Gene: rep, 1a-1b
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C6X7 (0-305)
      • engineered mutation (187)
    Domains in SCOPe 2.08: d4wy3a_
  • Heterogens: 3X5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4wy3A (A:)
sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir
ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng
spsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegk
fygpfvdiqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynye
pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqc
sgvtfq