PDB entry 4wxv

View 4wxv on RCSB PDB site
Description: Human cationic trypsin K97D mutant in complex with bovine pancreatic trypsin inhibitor (BPTI)
Class: Hydrolase/Hydrolase Inhibitor
Keywords: trypsin inhibitor, BPTI, Hydrolase-Hydrolase Inhibitor complex
Deposited on 2014-11-14, released 2015-07-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-09-09, with a file datestamp of 2015-09-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trypsin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PRSS1, TRP1, TRY1, TRYP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07477 (0-223)
      • engineered mutation (78)
      • engineered mutation (98)
      • engineered mutation (176)
    Domains in SCOPe 2.06: d4wxva_
  • Chain 'B':
    Compound: Trypsin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PRSS1, TRP1, TRY1, TRYP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07477 (0-223)
      • engineered mutation (78)
      • engineered mutation (98)
      • engineered mutation (176)
    Domains in SCOPe 2.06: d4wxvb_
  • Chain 'C':
    Compound: pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4wxvc_
  • Chain 'I':
    Compound: pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4wxvi_
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4wxvA (A:)
ivggynceensvpyqvslnsgyhfcggslineqwvvsaghcyksriqvrlgehnievleg
neqfinaakiirhpqydrdtlnndimliklssravinahvstislptappatgtkclisg
wgntassgadypdelqcldapvlsqakceasypgkitsnmfcvgfleggkdscqgdaggp
vvcngqlqgvvswgdgcaqknkpgvytkvynyvkwikntiaans

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4wxvB (B:)
ivggynceensvpyqvslnsgyhfcggslineqwvvsaghcyksriqvrlgehnievleg
neqfinaakiirhpqydrdtlnndimliklssravinahvstislptappatgtkclisg
wgntassgadypdelqcldapvlsqakceasypgkitsnmfcvgfleggkdscqgdaggp
vvcngqlqgvvswgdgcaqknkpgvytkvynyvkwikntiaans

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4wxvC (C:)
rpdfcleppytgpckariiryfynakaglcqtfvyggcrakrnnfksaedcmrtc

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4wxvI (I:)
rpdfcleppytgpckariiryfynakaglcqtfvyggcrakrnnfksaedcmrtc