PDB entry 4wxr

View 4wxr on RCSB PDB site
Description: X-ray crystal structure of NS3 Helicase from HCV with a bound inhibitor at 2.42 A resolution
Class: hydrolase/hydrolase inhibitor
Keywords: Helicase, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2014-11-14, released 2015-12-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-12-23, with a file datestamp of 2015-12-18.
Experiment type: XRAY
Resolution: 2.42 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ns3
    Species: Hepatitis C virus [TaxId:11103]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4wxra1, d4wxra2
  • Chain 'B':
    Compound: ns3
    Species: Hepatitis C virus [TaxId:11103]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4wxrb1, d4wxrb2
  • Heterogens: 3VZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4wxrA (A:)
    rspvftdnssppavpqsfqvahlhaptgsgkstkvpaayaaqgykvlvlnpsvaatlgfg
    aymskahgvdpnirtgvrtittgspitystygkfladggcsggaydiiicdechstdats
    ilgigtvldqaetagarlvvlatatppgsvtvshpnieevalsttgeipfygkaiplevi
    kggrhlifchskkkcdelaaklvalginavayyrgldvsviptsgdvvvvstdalmtgft
    gdfdsvidcntcvtqtvdfsldptftietttlpqdavsrtqrrgrtgrgkpgiyrfvapg
    erpsgmfdssvlcecydagcawyeltpaettvrlraymntpglpvcqdhlefwegvftgl
    thidahflsqtkqsgenfpylvayqatvcaraqapppswdqmwkclirlkptlhgptpll
    yrlgavqnevtlthpitkyimtcmsadlevv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wxrA (A:)
    ppavpqsfqvahlhaptgsgkstkvpaayaaqgykvlvlnpsvaatlgfgaymskdpnir
    tgvrtittgspitystygkfladggcsaydiiicdechstdatsilgigtvldqaetaga
    rlvvlatatppgsvtvshpnieevalsttgeipfygkaiplevikggrhlifchskkkcd
    elaaklvalginavayyrgldvsviptsgdvvvvstdatgdfdsvidcntcvtqtvdfsl
    dptftietttlpqdavsrtqrrgrtgrgkpgiyrfvapgerpsgmfdssvlcecydagca
    wyeltpaettvrlraymntpglpvcqdhlefwegvftglthidahflsqtkqsgenfpyl
    vayqatvcaraqapppswdqmwkclirlkptlhgptpllyrlgavqnevtlthpitkyim
    tcmsadl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4wxrB (B:)
    rspvftdnssppavpqsfqvahlhaptgsgkstkvpaayaaqgykvlvlnpsvaatlgfg
    aymskahgvdpnirtgvrtittgspitystygkfladggcsggaydiiicdechstdats
    ilgigtvldqaetagarlvvlatatppgsvtvshpnieevalsttgeipfygkaiplevi
    kggrhlifchskkkcdelaaklvalginavayyrgldvsviptsgdvvvvstdalmtgft
    gdfdsvidcntcvtqtvdfsldptftietttlpqdavsrtqrrgrtgrgkpgiyrfvapg
    erpsgmfdssvlcecydagcawyeltpaettvrlraymntpglpvcqdhlefwegvftgl
    thidahflsqtkqsgenfpylvayqatvcaraqapppswdqmwkclirlkptlhgptpll
    yrlgavqnevtlthpitkyimtcmsadlevv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wxrB (B:)
    dnssppavpqsfqvahlhaptgsgkstkvpaayaaqgykvlvlnpsvaatlgfgaymska
    hdpnirtgvrtittgspitystygkfladggcsggaydiiicdechstdatsilgigtvl
    dqaetagarlvvlatatppgsvtvshpnieevalsttgeipfygkaiplevikggrhlif
    chskkkcdelaaklvalginavayyrgldvsviptsgdvvvvstdaltgdfdsvidcntc
    vtqtvdfsldptftietttlpqdavsrtqrrgrtgrgkpgiyrfvapgerpsgmfdssvl
    cecydagcawyeltpaettvrlraymntpglpvcqdhlefwegvftglthidahflsqtk
    qsgenfpylvayqatvcaraqapppswdqmwkclirlkptlhgptpllyrlgavqnevtl
    thpitkyimtcmsadlev