PDB entry 4wwp

View 4wwp on RCSB PDB site
Description: Crystal structure of human PI3K-gamma in complex with pyridinylquinoline inhibitor N-{(1S)-1-[8-chloro-2-(2-methylpyridin-3-yl)quinolin-3-yl]ethyl}-9H-purin-6-amine
Class: transferase/transferase inhibitor
Keywords: kinase, phosphotransfer, PIP2, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2014-11-11, released 2014-12-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
    Species: Homo sapiens [TaxId:9606]
    Gene: PIK3CG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4wwpa1, d4wwpa2, d4wwpa3, d4wwpa4
  • Heterogens: SO4, 3VE, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4wwpA (A:)
    seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt
    skplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdipe
    sqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkeew
    plvddctgvtgyheqltihgkdhesvftvslwdcdrkfrvkirgidipvlprntdltvfv
    eaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycgkapalss
    kasaespsseskgkvqllyyvnlllidhrfllrrgeyvlhmwqisgkgedqgsfnadklt
    satnpdkensmsisilldnychpialpkhqptpdpegdrvraempnqlrkqleaiiatdp
    lnpltaedkellwhfryeslkhpkaypklfssvkwgqqeivaktyqllarrevwdqsald
    vgltmqlldcnfsdenvraiavqklesledddvlhyllqlvqavkfepyhdsalarfllk
    rglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcgtamlhdftqqvqviemlq
    kvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrvpydpglkagalaiekckv
    maskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilrimesiwetesldlc
    llpygcistgdkigmieivkdattiakiqqstvgntgafkdevlnhwlkekspteekfqa
    averfvyscagycvatfvlgigdrhndnimitetgnlfhidfghilgnyksflginkerv
    pfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtgmpqlt
    skedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlvlgikqgekhsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wwpA (A:)
    qafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvtskpl
    peylwkkianncifivihrsttsqtikvspddtpgailqvlrvcgrdeylvgetpiknfq
    wvrhclkngeeihvvldtppdpaldevrkeetvslwdcdrkfrvkirgidipvlltvfve
    aniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycgkkvqllyy
    vnlllidhrfllrrgeyvlhmwqissfnadkltsatnpdkensmsisilldnempnqlrk
    qleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwgqqeivaktyqllar
    revwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyllqlvqavkfepyh
    dsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcgtamlhdft
    qqvqviemlqkvtldikslsdvssqvisqlkqklenlqnsqlpesfrvpydpglkagala
    iekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilrimesiwet
    esldlcllpygcistgdkigmieivkdattiakiqqstvgntgafkdevlnhwlkekspt
    eekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfghikervpfvlt
    pdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtgmptskediey
    irdaltvgkneedakkyfldqievcrdkgwtvqfnwflhl