PDB entry 4wwn

View 4wwn on RCSB PDB site
Description: Crystal structure of human PI3K-gamma in complex with (S)-N-(1-(7-fluoro-2-(pyridin-2-yl)quinolin-3-yl)ethyl)-9H-purin-6-amine AMG319 inhibitor
Class: transferase/transferase inhibitor
Keywords: kinase, phosphotransfer, PIP2
Deposited on 2014-11-11, released 2014-12-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-01-28, with a file datestamp of 2015-01-23.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.221
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
    Species: Homo sapiens [TaxId:9606]
    Gene: PIK3CG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4wwna1, d4wwna2, d4wwna3, d4wwna4
  • Heterogens: SO4, 3VC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4wwnA (A:)
    seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt
    skplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdipe
    sqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkeew
    plvddctgvtgyheqltihgkdhesvftvslwdcdrkfrvkirgidipvlprntdltvfv
    eaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycgkapalss
    kasaespsseskgkvqllyyvnlllidhrfllrrgeyvlhmwqisgkgedqgsfnadklt
    satnpdkensmsisilldnychpialpkhqptpdpegdrvraempnqlrkqleaiiatdp
    lnpltaedkellwhfryeslkhpkaypklfssvkwgqqeivaktyqllarrevwdqsald
    vgltmqlldcnfsdenvraiavqklesledddvlhyllqlvqavkfepyhdsalarfllk
    rglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcgtamlhdftqqvqviemlq
    kvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrvpydpglkagalaiekckv
    maskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilrimesiwetesldlc
    llpygcistgdkigmieivkdattiakiqqstvgntgafkdevlnhwlkekspteekfqa
    averfvyscagycvatfvlgigdrhndnimitetgnlfhidfghilgnyksflginkerv
    pfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtgmpqlt
    skedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlvlgikqgekhsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wwnA (A:)
    seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt
    skplpeylwkkianncifivihrsttsqtikvspddtpgaidfvlrvcgrdeylvgetpi
    knfqwvrhclkngeeihvvldtppdpaldevrketvslwdcdrkfrvkirgidipvlltv
    fveaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycgkvqll
    yyvnlllidhrfllrrgeyvlhmwqissfnadkltsatnpdkensmsisilldnhpialp
    khqempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwgqqe
    ivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyllq
    lvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileaylr
    gcgtamlhdftqqvqviemlqkvtldikslsdvssqvisqlkqklenlqnsqlpesfrvp
    ydpglkagalaiekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilq
    ilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvgntgafkdev
    lnhwlkekspteekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfg
    hikervpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmt
    gmpqltskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwfl